You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08173
Secondary Accession Numbers
  • 13884
Name Solute carrier organic anion transporter family member 4C1
Synonyms
  1. OATP-H
  2. OATP-M1
  3. Organic anion transporter M1
  4. Solute carrier family 21 member 20
Gene Name SLCO4C1
Protein Type Transporter
Biological Properties
General Function Involved in transporter activity
Specific Function Organic anion transporter, capable of transporting pharmacological substances such as digoxin, ouabain, thyroxine, methotrexate and cAMP. May participate in the regulation of membrane transport of ouabain. Involved in the uptake of the dipeptidyl peptidase-4 inhibitor sitagliptin and hence may play a role in its transport into and out of renal proximal tubule cells. May be involved in the first step of the transport pathway of digoxin and various compounds into the urine in the kidney. May be involved in sperm maturation by enabling directed movement of organic anions and compounds within or between cells. This ion- transporting process is important to maintain the strict epididymal homeostasis necessary for sperm maturation. May have a role in secretory functions since seminal vesicle epithelial cells are assumed to secrete proteins involved in decapacitation by modifying surface proteins to facilitate the acquisition of the ability to fertilize the egg
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transporter activity
Process
establishment of localization
transport
Cellular Location
  1. Multi-pass membrane protein
  2. Basolateral cell membrane
Gene Properties
Chromosome Location Chromosome:5
Locus 5q21.2
SNPs SLCO4C1
Gene Sequence
>2175 bp
ATGAAGAGCGCCAAAGGTATTGAGAACTTGGCTTTTGTCCCCTCCAGCCCAGACATCCTG
CGCCGCTTGTCTGCGTCGCCCTCCCAAATCGAAGTCTCTGCCTTGTCCTCTGACCCCCAA
AGAGAGAATTCTCAGCCACAGGAGCTTCAGAAGCCCCAGGAGCCCCAGAAGTCACCAGAG
CCATCTCTGCCTTCAGCCCCTCCCAATGTCTCCGAAGAGAAGCTCCGGTCACTGTCGCTG
TCCGAGTTTGAGGAGGGGTCTTACGGCTGGAGGAACTTCCATCCTCAATGTCTCCAGCGC
TGCAACACACCTGGAGGCTTTCTGCTTCACTACTGCCTCTTGGCCGTCACGCAAGGTATT
GTAGTTAATGGCCTAGTAAATATTAGCATTTCCACTGTTGAGAAGCGTTATGAAATGAAG
AGTTCCCTGACTGGCCTGATTTCATCAAGCTACGATATTTCATTCTGTTTGTTGTCTTTA
TTTGTATCATTCTTTGGTGAAAGAGGACATAAGCCGAGATGGCTTGCATTTGCAGCCTTT
ATGATTGGACTGGGAGCACTTGTATTCTCATTGCCACAATTTTTCAGTGGAGAATATAAA
TTGGGGTCTCTTTTTGAAGACACTTGTGTAACAACAAGGAATAGCACCAGTTGTACATCT
TCAACTTCTTCACTTTCTAACTACTTGTATGTCTTCATCTTGGGACAACTATTGCTGGGG
GCAGGAGGAACTCCTCTTTATACTCTGGGAACAGCCTTTCTTGATGATTCTGTGCCCACA
CACAAGTCTTCTCTCTATATAGGAACCGGTTATGCTATGTCAATCTTAGGCCCTGCTATT
GGCTATGTATTGGGAGGACAACTGCTAACCATATACATTGATGTTGCTATGGGAGAAAGC
ACTGATGTCACTGAGGATGATCCGCGATGGTTGGGAGCTTGGTGGATTGGGTTTCTTCTA
TCATGGATCTTTGCTTGGTCTTTAATAATACCTTTTTCTTGCTTTCCAAAACATTTACCA
GGTACAGCAGAAATTCAAGCTGGAAAAACTTCCCAGGCTCATCAGAGTAATAGTAATGCA
GATGTGAAATTTGGAAAAAGTATTAAAGATTTTCCAGCTGCTCTAAAGAATTTGATGAAG
AATGCTGTCTTTATGTGTTTAGTTCTATCAACTTCTTCAGAAGCCTTAATTACTACTGGA
TTTGCTACATTTTTACCTAAATTTATAGAAAATCAATTCGGATTGACATCCAGCTTCGCA
GCTACTCTTGGAGGGGCTGTTTTAATTCCTGGAGCTGCTCTCGGTCAAATTTTAGGTGGC
TTCCTTGTTTCAAAATTCAGAATGACATGTAAAAACACAATGAAGTTTGCACTGTTCACA
TCTGGAGTTGCACTTACGCTGAGTTTTGTATTTATGTATGCCAAATGTGAAAATGAGCCA
TTTGCTGGTGTATCTGAATCATATAATGGGACTGGAGAATTGGGAAACTTGATAGCCCCT
TGTAATGCCAATTGTAACTGTTCGCGATCATATTATTATCCTGTCTGTGGAGATGGAGTC
CAATATTTTTCTCCCTGCTTTGCAGGCTGTTCAAACCCAGTTGCACACAGGAAGCCAAAG
GTATATTACAACTGTTCCTGTATTGAAAGGAAAACAGAAATAACATCCACTGCAGAAACT
TTTGGTTTTGAAGCTAAAGCTGGAAAATGTGAAACTCATTGTGCGAAACTGCCCATATTC
CTTTGCATTTTCTTTATTGTAATTATTTTTACCTTTATGGCCGGTACTCCTATAACTGTG
TCTATCCTAAGGTGTGTTAATCACAGACAACGGTCCCTAGCCTTGGGAATACAATTTATG
GTCCTTCGATTATTAGGAACAATTCCTGGACCAATTATATTTGGTTTCACAATAGACAGC
ACATGTATTCTTTGGGATATAAATGATTGTGGAATTAAAGGAGCTTGCTGGATTTATGAT
AACATCAAGATGGCCCATATGCTAGTAGCCATAAGTGTTACTTGTAAAGTTATCACCATG
TTCTTCAATGGATTTGCAATCTTTTTGTATAAACCACCTCCATCAGCCACAGATGTGTCA
TTTCATAAAGAGAATGCAGTTGTGACTAATGTTTTAGCAGAACAGGATCTCAACAAAATA
GTAAAAGAAGGGTGA
Protein Properties
Number of Residues 724
Molecular Weight 78947.5
Theoretical pI 7.57
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 106-126
  • 145-165
  • 175-195
  • 229-249
  • 273-293
  • 310-330
  • 382-402
  • 423-443
  • 454-474
  • 578-598
  • 624-644
  • 668-688
Protein Sequence
>Solute carrier organic anion transporter family member 4C1
MKSAKGIENLAFVPSSPDILRRLSASPSQIEVSALSSDPQRENSQPQELQKPQEPQKSPE
PSLPSAPPNVSEEKLRSLSLSEFEEGSYGWRNFHPQCLQRCNTPGGFLLHYCLLAVTQGI
VVNGLVNISISTVEKRYEMKSSLTGLISSSYDISFCLLSLFVSFFGERGHKPRWLAFAAF
MIGLGALVFSLPQFFSGEYKLGSLFEDTCVTTRNSTSCTSSTSSLSNYLYVFILGQLLLG
AGGTPLYTLGTAFLDDSVPTHKSSLYIGTGYAMSILGPAIGYVLGGQLLTIYIDVAMGES
TDVTEDDPRWLGAWWIGFLLSWIFAWSLIIPFSCFPKHLPGTAEIQAGKTSQAHQSNSNA
DVKFGKSIKDFPAALKNLMKNAVFMCLVLSTSSEALITTGFATFLPKFIENQFGLTSSFA
ATLGGAVLIPGAALGQILGGFLVSKFRMTCKNTMKFALFTSGVALTLSFVFMYAKCENEP
FAGVSESYNGTGELGNLIAPCNANCNCSRSYYYPVCGDGVQYFSPCFAGCSNPVAHRKPK
VYYNCSCIERKTEITSTAETFGFEAKAGKCETHCAKLPIFLCIFFIVIIFTFMAGTPITV
SILRCVNHRQRSLALGIQFMVLRLLGTIPGPIIFGFTIDSTCILWDINDCGIKGACWIYD
NIKMAHMLVAISVTCKVITMFFNGFAIFLYKPPPSATDVSFHKENAVVTNVLAEQDLNKI
VKEG
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q6ZQN7
UniProtKB/Swiss-Prot Entry Name SO4C1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF401643
GeneCard ID SLCO4C1
GenAtlas ID SLCO4C1
HGNC ID HGNC:23612
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Mikkaichi T, Suzuki T, Onogawa T, Tanemoto M, Mizutamari H, Okada M, Chaki T, Masuda S, Tokui T, Eto N, Abe M, Satoh F, Unno M, Hishinuma T, Inui K, Ito S, Goto J, Abe T: Isolation and characterization of a digoxin transporter and its rat homologue expressed in the kidney. Proc Natl Acad Sci U S A. 2004 Mar 9;101(10):3569-74. Epub 2004 Mar 1. [PubMed:14993604 ]
  3. Chu XY, Bleasby K, Yabut J, Cai X, Chan GH, Hafey MJ, Xu S, Bergman AJ, Braun MP, Dean DC, Evers R: Transport of the dipeptidyl peptidase-4 inhibitor sitagliptin by human organic anion transporter 3, organic anion transporting polypeptide 4C1, and multidrug resistance P-glycoprotein. J Pharmacol Exp Ther. 2007 May;321(2):673-83. Epub 2007 Feb 21. [PubMed:17314201 ]