You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08343
Secondary Accession Numbers
  • 14055
Name Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein
Synonyms
  1. DEP domain-containing protein 2
  2. P-Rex2
  3. PtdIns(3,4,5)-dependent Rac exchanger 2
Gene Name PREX2
Protein Type Unknown
Biological Properties
General Function Involved in intracellular signaling pathway
Specific Function Functions as a RAC1 guanine nucleotide exchange factor (GEF), activating Rac proteins by exchanging bound GDP for free GTP. Its activity is synergistically activated by phosphatidylinositol-3,4,5-triphosphate and the beta gamma subunits of heterotrimeric G protein. Mediates the activation of RAC1 in a PI3K-dependent manner. May be an important mediator of Rac signaling, acting directly downstream of both G protein- coupled receptors and phosphoinositide 3-kinase
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
small gtpase regulator activity
binding
ras guanyl-nucleotide exchange factor activity
rho guanyl-nucleotide exchange factor activity
enzyme regulator activity
protein binding
nucleoside-triphosphatase regulator activity
gtpase regulator activity
guanyl-nucleotide exchange factor activity
Process
regulation of ras protein signal transduction
regulation of rho protein signal transduction
biological regulation
regulation of biological process
regulation of cellular process
intracellular signaling pathway
signaling
signaling pathway
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:8
Locus 8q13.2
SNPs PREX2
Gene Sequence
>4821 bp
ATGAGCGAGGACAGCCGCGGAGACAGCCGCGCCGAGAGCGCCAAGGACCTGGAGAAGCAG
CTTCGCCTGCGCGTGTGCGTGCTCAGCGAGCTCCAGAAGACCGAGCGGGACTATGTGGGC
ACGCTGGAGTTCCTGGTGTCGGCATTCTTACACAGAATGAACCAGTGTGCAGCATCAAAA
GTTGACAAAAATGTGACAGAAGAAACAGTGAAGATGTTGTTCTCAAACATTGAAGACATC
CTTGCAGTACATAAAGAATTCTTAAAAGTCGTGGAAGAATGCTTACACCCCGAACCTAAT
GCTCAACAAGAAGTGGGAACCTGCTTTCTTCACTTTAAAGACAAGTTTCGTATCTATGAT
GAATATTGTAGTAACCATGAGAAGGCACAAAAATTACTTCTTGAACTCAACAAAATAAGA
ACAATCCGGACATTTCTTTTGAACTGCATGCTGCTTGGAGGACGGAAGAACACAGATGTT
CCCTTGGAAGGATATTTAGTAACACCAATACAAAGAATATGCAAGTACCCTCTTATTTTG
AAGGAGTTGCTGAAGCGGACTCCACGGAAACACAGTGACTATGCAGCAGTGATGGAAGCC
CTCCAAGCCATGAAAGCTGTCTGTTCCAACATAAACGAGGCCAAGAGACAGATGGAGAAG
TTAGAAGTTTTAGAGGAATGGCAGTCTCACATTGAAGGCTGGGAGGGGTCCAACATCACT
GACACCTGCACTGAAATGCTAATGTGTGGAGTCTTACTGAAAATTTCTTCTGGAAATATT
CAAGAACGGGTGTTTTTTCTTTTCGATAATCTTTTGGTGTACTGCAAAAGAAAACACAGA
CGGTTGAAGAACAGCAAGGCATCTACAGATGGACATCGGTACCTTTTTCGTGGCCGGATC
AACACGGAGGTGATGGAAGTGGAGAATGTGGATGATGGCACCGCTGATTTCCATAGCAGT
GGACACATTGTTGTTAATGGATGGAAGATACATAACACAGCAAAAAATAAATGGTTTGTT
TGTATGGCAAAAACACCTGAAGAGAAGCATGAATGGTTTGAAGCTATTTTGAAAGAAAGA
GAACGGCGGAAAGGTTTAAAATTAGGAATGGAGCAAGATACCTGGGTCATGATCTCTGAA
CAGGGTGAGAAACTTTATAAAATGATGTGCAGACAAGGAAATCTGATCAAAGACCGAAAG
AGAAAACTGACTACGTTCCCTAAATGCTTTCTTGGAAGCGAATTTGTGTCATGGCTGTTG
GAAATTGGAGAGATTCACAGGCCTGAGGAAGGCGTGCACTTGGGACAAGCATTATTAGAA
AATGGAATCATTCACCATGTTACTGATAAACATCAATTCAAACCAGAACAGATGTTATAT
AGATTTCGCTATGATGATGGAACATTTTATCCAAGAAATGAGATGCAGGACGTGATTTCA
AAGGGTGTAAGATTATATTGTCGTCTTCATAGCCTTTTTACTCCAGTGATAAGAGATAAA
GATTACCATTTAAGGACCTACAAATCTGTGGTCATGGCCAACAAACTGATAGACTGGTTA
ATTGCACAGGGAGATTGCCGCACCAGAGAAGAGGCAATGATATTTGGCGTTGGACTCTGT
GACAATGGATTTATGCACCATGTCCTTGAAAAAAGCGAATTCAAAGATGAACCCCTACTT
TTCCGTTTTTTTTCGGATGAGGAAATGGAGGGATCAAATATGAAACATCGACTTATGAAA
CATGACTTAAAAGTTGTGGAAAATGTTATAGCTAAGTCATTATTGATTAAATCCAATGAA
GGCAGCTATGGCTTTGGATTAGAAGACAAAAATAAAGTTCCAATAATAAAGTTGGTAGAA
AAGGGATCTAATGCTGAGATGGCTGGCATGGAAGTCGGGAAAAAGATTTTTGCTATTAAT
GGTGACCTAGTTTTTATGAGACCTTTCAATGAAGTGGATTGCTTCCTGAAATCGTGTTTA
AACAGCAGAAAACCTCTAAGAGTTCTTGTGAGCACAAAGCCAAGAGAGACAGTGAAAATT
CCAGATTCAGCTGATGGACTTGGCTTCCAGATCCGGGGATTTGGCCCTTCTGTTGTGCAT
GCTGTAGGAAGAGGAACTGTGGCTGCAGCAGCTGGTCTTCACCCTGGACAGTGCATTATC
AAGGTGAATGGAATCAATGTCAGCAAAGAGACACATGCCAGTGTCATTGCACACGTTACA
GCCTGCAGGAAGTACAGGCGGCCAACGAAGCAAGATTCCATACAATGGGTTTATAATAGC
ATTGAGAGTGCTCAAGAAGACCTTCAAAAATCTCACTCCAAGCCCCCTGGAGATGAAGCA
GGGGATGCTTTTGACTGTAAAGTAGAAGAGGTTATTGACAAATTCAACACTATGGCCATC
ATTGATGGGAAGAAGGAGCATGTGAGTCTGACAGTGGACAATGTCCACCTGGAATATGGT
GTCGTGTATGAGTACGACAGCACAGCTGGCATCAAGTGCAATGTGGTGGAAAAGATGATT
GAGCCCAAAGGTTTCTTCAGCTTAACTGCCAAGATTCTTGAAGCCCTGGCTAAAAGTGAT
GAGCATTTTGTACAAAACTGTACCAGCCTAAATTCTCTAAATGAAGTGATTCCTACTGAC
CTTCAGAGTAAATTCAGTGCCCTTTGCAGTGAAAGAATTGAACACCTATGTCAGAGAATA
TCCAGTTATAAAAAGTTTTCTCGTGTACTGAAGAATAGGGCCTGGCCTACTTTTAAACAG
GCCAAATCTAAAATCTCCCCACTGCACAGCAGTGATTTCTGCCCTACCAACTGCCATGTC
AATGTGATGGAAGTTTCTTATCCCAAAACATCAACCTCTTTGGGAAGTGCATTTGGTGTT
CAGTTGGATAGCAGGAAGCATAATTCTCATGATAAAGAAAACAAATCTTCGGAGCAAGGG
AAACTGAGCCCTATGGTGTACATTCAGCACACCATCACAACCATGGCGGCCCCTTCAGGT
CTGTCTCTGGGACAGCAGGATGGCCATGGTCTCAGGTATCTGCTAAAAGAAGAAGACTTA
GAAACCCAAGACATCTATCAGAAACTGCTGGGCAAACTTCAGACTGCACTGAAAGAGGTG
GAGATGTGTGTTTGTCAAATAGATGACCTTCTGTCTTCAATAACATATTCTCCTAAATTA
GAACGTAAGACATCAGAGGGCATAATACCAACAGACAGTGACAATGAGAAGGGAGAAAGA
AACAGCAAACGGGTATGTTTTAATGTAGCAGGAGATGAACAGGAAGATTCTGGTCATGAC
ACCATCAGCAACAGAGACTCTTACAGTGACTGCAACAGCAATAGGAATTCCATCGCCTCC
TTCACCAGCATCTGCAGCAGCCAGTGCAGCTCGTATTTCCACAGTGATGAAATGGACTCA
GGTGATGAACTTCCCTTAAGTGTTCGCATATCTCATGATAAACAGGACAAGATACATAGT
TGCCTTGAGCATCTTTTCAGCCAGGTGGATTCAATTACCAATCTCCTAAAAGGGCAGGCT
GTTGTGAGGGCCTTTGACCAAACCAAGTATCTCACTCCAGGCCGAGGATTGCAAGAATTT
CAACAGGAAATGGAACCAAAGCTGAGTTGTCCAAAAAGGCTACGGCTTCATATCAAGCAA
GATCCTTGGAATCTTCCCAGCAGCGTCCGGACTCTTGCTCAGAACATCAGGAAATTTGTT
GAAGAGGTAAAGTGTAGGCTACTCCTGGCTCTTCTTGAATATTCAGATAGTGAGACACAG
CTCCGTAGAGACATGGTTTTCTGCCAGACTCTTGTGGCCACTGTCTGTGCCTTCTCTGAG
CAGCTCATGGCGGCCTTGAACCAGATGTTTGACAACAGCAAGGAAAATGAGATGGAAACT
TGGGAAGCCAGCAGGAGGTGGCTGGACCAGATAGCGAATGCAGGTGTTCTTTTTCACTTT
CAGTCACTTCTGTCACCAAACTTGACAGATGAACAAGCCATGTTAGAAGATACACTGGTT
GCACTATTTGATTTGGAAAAGGTTTCCTTTTACTTTAAACCATCAGAAGAGGAACCTCTG
GTTGCAAATGTTCCTCTTACATATCAAGCAGAAGGAAGTCGGCAAGCTCTGAAAGTTTAC
TTCTACATTGATAGTTATCATTTTGAACAACTTCCTCAACGGCTGAAAAATGGAGGAGGG
TTTAAAATTCATCCTGTTCTTTTTGCACAAGCACTAGAGAGCATGGAAGGATATTATTAC
AGAGACAATGTTTCTGTGGAAGAATTTCAAGCTCAGATAAATGCAGCCTCACTGGAAAAG
GTCAAACAGTACAACCAGAAGCTCAGGGCATTCTACTTGGACAAGTCAAATTCACCACCA
AACTCCACATCCAAAGCTGCCTATGTAGATAAGCTAATGAGGCCTCTCAACGCTTTGGAT
GAACTTTACCGACTGGTAGCCTCGTTTATCAGATCCAAGCGCACAGCTGCCTGTGCAAAC
ACAGCTTGCAGTGCTTCTGGGGTTGGACTGCTGTCAGTTTCCTCGGAGCTGTGCAACAGG
CTGGGCGCCTGCCACATCATCATGTGCAGCAGCGGTGTGCATCGGTGCACCCTGAGCGTG
ACGCTGGAGCAAGCCATCATTCTGGCCAGAAGCCACGGACTGCCACCTCGTTACATCATG
CAGGCTACAGATGTGATGCGGAAGCAGGGAGCAAGAGTTCAGAACACAGCGAAGAATTTG
GGAGTCAGAGACCGGACTCCACAGTCTGCACCAAGGCTGTACAAGCTGTGCGAGCCACCT
CCCCCAGCTGGAGAAGAATGA
Protein Properties
Number of Residues 1606
Molecular Weight 182620.5
Theoretical pI 7.46
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein
MSEDSRGDSRAESAKDLEKQLRLRVCVLSELQKTERDYVGTLEFLVSAFLHRMNQCAASK
VDKNVTEETVKMLFSNIEDILAVHKEFLKVVEECLHPEPNAQQEVGTCFLHFKDKFRIYD
EYCSNHEKAQKLLLELNKIRTIRTFLLNCMLLGGRKNTDVPLEGYLVTPIQRICKYPLIL
KELLKRTPRKHSDYAAVMEALQAMKAVCSNINEAKRQMEKLEVLEEWQSHIEGWEGSNIT
DTCTEMLMCGVLLKISSGNIQERVFFLFDNLLVYCKRKHRRLKNSKASTDGHRYLFRGRI
NTEVMEVENVDDGTADFHSSGHIVVNGWKIHNTAKNKWFVCMAKTPEEKHEWFEAILKER
ERRKGLKLGMEQDTWVMISEQGEKLYKMMCRQGNLIKDRKRKLTTFPKCFLGSEFVSWLL
EIGEIHRPEEGVHLGQALLENGIIHHVTDKHQFKPEQMLYRFRYDDGTFYPRNEMQDVIS
KGVRLYCRLHSLFTPVIRDKDYHLRTYKSVVMANKLIDWLIAQGDCRTREEAMIFGVGLC
DNGFMHHVLEKSEFKDEPLLFRFFSDEEMEGSNMKHRLMKHDLKVVENVIAKSLLIKSNE
GSYGFGLEDKNKVPIIKLVEKGSNAEMAGMEVGKKIFAINGDLVFMRPFNEVDCFLKSCL
NSRKPLRVLVSTKPRETVKIPDSADGLGFQIRGFGPSVVHAVGRGTVAAAAGLHPGQCII
KVNGINVSKETHASVIAHVTACRKYRRPTKQDSIQWVYNSIESAQEDLQKSHSKPPGDEA
GDAFDCKVEEVIDKFNTMAIIDGKKEHVSLTVDNVHLEYGVVYEYDSTAGIKCNVVEKMI
EPKGFFSLTAKILEALAKSDEHFVQNCTSLNSLNEVIPTDLQSKFSALCSERIEHLCQRI
SSYKKFSRVLKNRAWPTFKQAKSKISPLHSSDFCPTNCHVNVMEVSYPKTSTSLGSAFGV
QLDSRKHNSHDKENKSSEQGKLSPMVYIQHTITTMAAPSGLSLGQQDGHGLRYLLKEEDL
ETQDIYQKLLGKLQTALKEVEMCVCQIDDLLSSITYSPKLERKTSEGIIPTDSDNEKGER
NSKRVCFNVAGDEQEDSGHDTISNRDSYSDCNSNRNSIASFTSICSSQCSSYFHSDEMDS
GDELPLSVRISHDKQDKIHSCLEHLFSQVDSITNLLKGQAVVRAFDQTKYLTPGRGLQEF
QQEMEPKLSCPKRLRLHIKQDPWNLPSSVRTLAQNIRKFVEEVKCRLLLALLEYSDSETQ
LRRDMVFCQTLVATVCAFSEQLMAALNQMFDNSKENEMETWEASRRWLDQIANAGVLFHF
QSLLSPNLTDEQAMLEDTLVALFDLEKVSFYFKPSEEEPLVANVPLTYQAEGSRQALKVY
FYIDSYHFEQLPQRLKNGGGFKIHPVLFAQALESMEGYYYRDNVSVEEFQAQINAASLEK
VKQYNQKLRAFYLDKSNSPPNSTSKAAYVDKLMRPLNALDELYRLVASFIRSKRTAACAN
TACSASGVGLLSVSSELCNRLGACHIIMCSSGVHRCTLSVTLEQAIILARSHGLPPRYIM
QATDVMRKQGARVQNTAKNLGVRDRTPQSAPRLYKLCEPPPPAGEE
GenBank ID Protein 47578115
UniProtKB/Swiss-Prot ID Q70Z35
UniProtKB/Swiss-Prot Entry Name PREX2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_024870.2
GeneCard ID PREX2
GenAtlas ID PREX2
HGNC ID HGNC:22950
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  3. Nusbaum C, Mikkelsen TS, Zody MC, Asakawa S, Taudien S, Garber M, Kodira CD, Schueler MG, Shimizu A, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Allen NR, Anderson S, Asakawa T, Blechschmidt K, Bloom T, Borowsky ML, Butler J, Cook A, Corum B, DeArellano K, DeCaprio D, Dooley KT, Dorris L 3rd, Engels R, Glockner G, Hafez N, Hagopian DS, Hall JL, Ishikawa SK, Jaffe DB, Kamat A, Kudoh J, Lehmann R, Lokitsang T, Macdonald P, Major JE, Matthews CD, Mauceli E, Menzel U, Mihalev AH, Minoshima S, Murayama Y, Naylor JW, Nicol R, Nguyen C, O'Leary SB, O'Neill K, Parker SC, Polley A, Raymond CK, Reichwald K, Rodriguez J, Sasaki T, Schilhabel M, Siddiqui R, Smith CL, Sneddon TP, Talamas JA, Tenzin P, Topham K, Venkataraman V, Wen G, Yamazaki S, Young SK, Zeng Q, Zimmer AR, Rosenthal A, Birren BW, Platzer M, Shimizu N, Lander ES: DNA sequence and analysis of human chromosome 8. Nature. 2006 Jan 19;439(7074):331-5. [PubMed:16421571 ]
  4. Donald S, Hill K, Lecureuil C, Barnouin R, Krugmann S, John Coadwell W, Andrews SR, Walker SA, Hawkins PT, Stephens LR, Welch HC: P-Rex2, a new guanine-nucleotide exchange factor for Rac. FEBS Lett. 2004 Aug 13;572(1-3):172-6. [PubMed:15304343 ]
  5. Rosenfeldt H, Vazquez-Prado J, Gutkind JS: P-REX2, a novel PI-3-kinase sensitive Rac exchange factor. FEBS Lett. 2004 Aug 13;572(1-3):167-71. [PubMed:15304342 ]
  6. Joseph RE, Norris FA: Substrate specificity and recognition is conferred by the pleckstrin homology domain of the Dbl family guanine nucleotide exchange factor P-Rex2. J Biol Chem. 2005 Jul 29;280(30):27508-12. Epub 2005 May 16. [PubMed:15897194 ]