You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08352
Secondary Accession Numbers
  • 14064
Name Dedicator of cytokinesis protein 1
Synonyms
  1. 180 kDa protein downstream of CRK
  2. DOCK180
Gene Name DOCK1
Protein Type Unknown
Biological Properties
General Function Involved in guanyl-nucleotide exchange factor activity
Specific Function Involved in cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility. Functions as a guanine nucleotide exchange factor (GEF), which activates Rac Rho small GTPases by exchanging bound GDP for free GTP. Its GEF activity may be enhanced by ELMO1
Pathways Not Available
Reactions Not Available
GO Classification
Function
purine nucleotide binding
binding
nucleotide binding
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
enzyme regulator activity
protein binding
gtpase binding
enzyme binding
nucleoside-triphosphatase regulator activity
gtpase regulator activity
guanyl-nucleotide exchange factor activity
Cellular Location
  1. Cytoplasm (Probable)
  2. Membrane (Probable)
Gene Properties
Chromosome Location Chromosome:1
Locus 10q26.13-q26.3
SNPs DOCK1
Gene Sequence
>5598 bp
ATGACGCGCTGGGTGCCCACCAAGCGCGAGGAGAAGTACGGCGTGGCTTTTTATAACTAT
GATGCCAGAGGAGCGGATGAACTTTCTTTACAGATCGGAGACACTGTGCACATCTTAGAA
ACATATGAAGGGTGGTACCGAGGTTACACGTTACGAAAAAAGTCTAAGAAGGGTATATTT
CCTGCTTCATATATTCATCTTAAAGAAGCGATAGTTGAAGGAAAAGGGCAACATGAAACA
GTCATCCCGGGTGACCTCCCCCTCATCCAGGAAGTCACCACGACACTCCGAGAGTGGTCC
ACCATCTGGAGGCAGCTCTACGTGCAAGATAACAGGGAGATGTTTCGAAGTGTGCGGCAC
ATGATCTATGACCTTATTGAATGGCGATCACAAATTCTTTCTGGAACTCTGCCTCAGGAT
GAACTCAAAGAACTGAAGAAGAAGGTCACAGCCAAAATTGATTATGGAAACAGAATTCTA
GATTTGGACCTGGTGGTTAGAGATGAAGATGGGAATATTTTGGATCCAGAATTAACTAGC
ACGATTAGTCTCTTCAGAGCTCATGAAATAGCTTCTAAACAAGTGGAGGAAAGGTTACAA
GAGGAAAAATCTCAAAAGCAGAACATAGATATTAACAGACAAGCCAAGTTTGCTGCAACC
CCTTCTCTGGCCTTGTTTGTGAACCTCAAAAATGTGGTTTGTAAAATAGGAGAAGATGCT
GAAGTCCTCATGTCTCTATATGACCCTGTGGAGTCCAAATTCATCAGTGAGAACTACCTG
GTTCGCTGGTCCAGTTCAGGATTACCTAAAGACATAGACAGATTACATAATTTGCGAGCC
GTGTTTACTGACCTCGGAAGCAAAGACCTGAAAAGGGAGAAAATCAGTTTTGTCTGTCAG
ATTGTTCGCGTGGGTCGCATGGAGCTGAGGGACAACAACACCAGGAAACTGACCTCGGGG
TTGCGGCGACCTTTTGGAGTGGCTGTGATGGATGTAACAGATATAATAAATGGAAAAGTA
GATGATGAAGATAAGCAGCATTTCATTCCCTTTCAGCCGGTGGCAGGGGAGAATGACTTC
CTTCAGACTGTTATAAACAAAGTCATCGCTGCCAAAGAAGTCAACCACAAGGGGCAGGGT
TTGTGGGTAACATTGAAATTACTTCCTGGAGATATCCATCAGATCCGAAAAGAGTTTCCG
CATTTAGTGGACAGGACCACAGCTGTGGCTCGAAAAACAGGGTTTCCGGAGATAATCATG
CCTGGTGATGTTCGAAATGATATCTATGTAACATTAGTTCAAGGAGATTTTGATAAAGGA
AGCAAAACAACAGCGAAGAACGTGGAGGTCACGGTGTCTGTGTACGATGAGGATGGGAAA
CGATTAGAGCATGTGATTTTCCCGGGTGCTGGTGATGAAGCGATTTCAGAGTACAAATCT
GTGATTTACTACCAAGTAAAGCAGCCACGCTGGTTTGAGACTGTTAAGGTGGCCATTCCC
ATCGAGGACGTTAACCGCAGTCACCTTCGGTTTACCTTCCGCCACAGGTCATCACAGGAC
TCTAAGGATAAATCTGAGAAAATATTTGCACTAGCATTTGTCAAGCTGATGAGATACGAT
GGTACCACCCTGCGAGACGGAGAGCACGATCTTATCGTCTATAAGGCCGAAGCAAAGAAG
CTGGAAGATGCTGCCACGTACTTGAGTCTGCCCTCCACGAAGGCAGAGTTGGAAGAAAAG
GGCCACTCGGCCACCGGCAAGAGCATGCAGAGCCTTGGGAGCTGCACCATTAGCAAGGAC
TCCTTCCAGATCTCCACGCTCGTGTGCTCCACCAAACTGACTCAGAACGTGGACCTTCTG
GGGCTCTTGAAATGGCGCTCCAACACCAGCCTGCTGCAGCAGAACTTGAGGCAGCTGATG
AAAGTCGATGGTGGTGAAGTAGTGAAGTTTCTTCAGGACACGTTGGATGCCCTCTTCAAC
ATCATGATGGAGAACTCAGAGAGTGAGACTTTTGACACGTTAGTCTTTGATGCTCTGGTA
TTTATCATTGGACTGATTGCTGATAGAAAATTTCAGCATTTTAATCCTGTTTTGGAAACT
TACATTAAGAAACACTTTAGTGCAACGTTAGCCTACACGAAGTTGACAAAAGTGTTGAAG
AACTACGTGGACGGTGCTGAGAAGCCGGGAGTAAATGAGCAGCTGTACAAAGCCATGAAA
GCGCTAGAATCCATCTTCAAGTTCATCGTGCGCTCCAGGATCCTGTTCAATCAACTGTAT
GAAAACAAGGGAGAGGCTGACTTCGTGGAATCTTTGCTGCAGCTCTTCAGGTCCATCAAT
GACATGATGAGCAGCATGTCAGACCAGACCGTCCGGGTGAAGGGGGCAGCACTGAAATAC
TTACCAACGATCGTCAACGATGTGAAATTGGTGTTTGATCCCAAAGAGCTCAGCAAAATG
TTTACTGAATTCATCCTCAATGTTCCCATGGGCTTGCTGACCATCCAGAAACTCTACTGC
TTGATCGAAATCGTCCACAGTGACCTCTTCACACAGCATGACTGCAGAGAGATCCTGCTT
CCCATGATGACCGATCAGCTCAAGTACCATCTGGAGAGACAGGAGGACCTGGAGGCCTGC
TGTCAGCTGCTCAGCCACATCCTGGAGGTGCTGTACAGGAAGGACGTGGGGCCAACCCAG
AGGCACGTCCAGATTATCATGGAGAAACTTCTCCGGACCGTGAACCGAACCGTCATTTCC
ATGGGACGAGATTCTGAACTCATTGGAAACTTCGTGGCTTGCATGACAGCTATTTTACGA
CAAATGGAAGATTACCATTATGCCCACTTGATCAAGACTTTTGGGAAAATGAGGACTGAT
GTGGTAGATTTCCTAATGGAAACATTCATCATGTTTAAGAACCTCATTGGAAAGAACGTT
TACCCCTTCGACTGGGTGATCATGAACATGGTGCAAAATAAAGTCTTCCTGCGAGCAATT
AATCAGTATGCAGATATGCTGAACAAAAAATTTCTGGATCAAGCCAACTTTGAGCTACAG
CTGTGGAACAACTACTTTCACCTGGCTGTTGCTTTCCTTACTCAAGAGTCCCTGCAACTG
GAGAATTTTTCAAGTGCCAAGAGAGCCAAAATCCTTAACAAGTACGGAGATATGAGGAGA
CAGATTGGCTTTGAAATCAGAGACATGTGGTACAACCTTGGTCAACACAAGATAAAGTTC
ATTCCAGAAATGGTGGGCCCAATATTAGAAATGACATTAATTCCCGAGACGGAGCTGCGC
AAAGCCACCATCCCCATCTTCTTTGATATGATGCAGTGTGAATTCCATTCGACCCGAAGC
TTCCAAATGTTTGAAAATGAGATCATCACCAAGCTGGATCATGAAGTCGAAGGAGGCAGA
GGAGACGAACAGTACAAAGTGTTATTTGATAAAATCCTTCTGGAACACTGCAGGAAGCAC
AAATACCTCGCCAAAACAGGAGAAACTTTTGTAAAACTCGTTGTGCGCTTAATGGAAAGG
CTTTTGGATTATAGAACCATCATGCACGACGAGAACAAAGAAAACCGCATGAGCTGCACC
GTCAATGTGCTGAATTTCTACAAAGAAATTGAAAGAGAAGAAATGTATATAAGGTATTTG
TACAAGCTCTGTGACCTGCACAAGGAGTGTGATAACTACACCGAAGCGGCTTACACCTTG
CTTCTCCATGCAAAGCTTCTTAAGTGGTCGGAGGATGTGTGTGTGGCCCACCTCACCCAG
CGGGACGGGTACCAGGCCACCACGCAGGGACAGCTGAAGGAGCAGCTCTACCAGGAAATC
ATCCACTACTTCGACAAAGGCAAGATGTGGGAGGAGGCCATTGCCTTGGGCAAGGAGCTA
GCCGAGCAGTATGAGAACGAAATGTTTGATTATGAGCAACTCAGCGAATTGCTGAAAAAA
CAGGCTCAGTTTTATGAAAACATCGTCAAAGTGATCAGGCCCAAGCCTGACTATTTTGCT
GTTGGCTACTACGGACAAGGGTTCCCCACATTCCTGCGGGGAAAAGTTTTCATTTACCGA
GGGAAAGAGTATGAGCGCCGGGAAGATTTTGAGGCTCGGCTCTTAACTCAGTTTCCAAAC
GCCGAGAAAATGAAGACAACATCTCCACCAGGCGACGATATTAAAAACTCTCCTGGCCAG
TATATTCAGTGCTTCACAGTGAAGCCCAAACTCGATCTGCCTCCTAAGTTTCACAGGCCA
GTGTCAGAGCAGATTGTAAGTTTTTACAGGGTGAACGAGGTCCAGCGATTTGAATATTCT
CGGCCAATCCGGAAGGGAGAGAAAAACCCAGACAATGAATTTGCGAATATGTGGATCGAG
AGAACCATATATACAACTGCATATAAATTACCTGGAATTTTAAGGTGGTTTGAGGTCAAG
TCTGTTTTCATGGTGGAAATCAGCCCCCTGGAGAATGCCATTGAGACCATGCAGCTGACG
AACGACAAGATCAACAGCATGGTGCAGCAGCACCTGGATGACCCCAGCCTGCCCATCAAC
CCGCTCTCCATGCTCCTGAACGGCATCGTGGACCCAGCTGTCATGGGGGGCTTCGCAAAC
TACGAAAAGGCCTTCTTTACAGACCGGTACCTGCAGGAGCACCCTGAGGCCCATGAAAAG
ATCGAGAAGCTCAAGGACCTGATTGCTTGGCAGATTCCTTTTCTGGCCGAAGGGATCAGA
ATCCATGGAGACAAAGTCACGGAGGCACTGAGGCCGTTCCACGAGAGGATGGAGGCCTGT
TTCAAACAGCTGAAGGAAAAGGTGGAGAAAGAGTACGGCGTCCGAATCATGCCCTCAAGT
CTGGATGATAGAAGAGGCAGCCGCCCCCGGTCCATGGTGCGGTCCTTCACGATGCCTTCC
TCATCCCGCCCTCTGTCTGTGGCCTCTGTCTCTTCCCTCTCATCGGACAGCACCCCTTCC
AGACCAGGCTCCGACGGGTTTGCCCTGGAGCCTCTCCTGCCAAAGAAAATGCACTCCAGG
TCCCAGGACAAGCTGGACAAGGATGACCTGGAGAAGGAGAAGAAGGACAAGAAGAAGGAA
AAAAGGAACAGCAAACATCAAGAGATATTTGAGAAAGAATTTAAACCCACCGACATTTCC
CTGCAGCAGTCTGAGGCTGTGATCCTTTCGGAAACGATAAGTCCCCTGCGGCCCCAGAGA
CCGAAGAGCCAGGTGATGAACGTCATTGGAAGCGAAAGGCGCTTCTCGGTGTCCCCCTCG
TCACCGTCCTCCCAGCAAACACCCCCTCCAGTTACACCAAGGGCCAAGCTCAGCTTCAGC
ATGCAGTCGAGCTTGGAGCTGAACGGCATGACGGGGGCGGACGTGGCCGATGTCCCACCC
CCTCTGCCTCTCAAAGGCAGCGTGGCAGATTACGGGAATTTGATGGAAAACCAGGACTTG
CTGGGCTCGCCAACACCTCCACCTCCCCCTCCACACCAGAGGCATCTGCCACCTCCACTG
CCCAGCAAAACTCCGCCTCCTCCCCCTCCAAAGACAACTCGCAAGCAGGCATCGGTGGAC
TCCGGGATCGTGCAGTGA
Protein Properties
Number of Residues 1865
Molecular Weight 215344.1
Theoretical pI 7.61
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Dedicator of cytokinesis protein 1
MTRWVPTKREEKYGVAFYNYDARGADELSLQIGDTVHILETYEGWYRGYTLRKKSKKGIF
PASYIHLKEAIVEGKGQHETVIPGDLPLIQEVTTTLREWSTIWRQLYVQDNREMFRSVRH
MIYDLIEWRSQILSGTLPQDELKELKKKVTAKIDYGNRILDLDLVVRDEDGNILDPELTS
TISLFRAHEIASKQVEERLQEEKSQKQNIDINRQAKFAATPSLALFVNLKNVVCKIGEDA
EVLMSLYDPVESKFISENYLVRWSSSGLPKDIDRLHNLRAVFTDLGSKDLKREKISFVCQ
IVRVGRMELRDNNTRKLTSGLRRPFGVAVMDVTDIINGKVDDEDKQHFIPFQPVAGENDF
LQTVINKVIAAKEVNHKGQGLWVTLKLLPGDIHQIRKEFPHLVDRTTAVARKTGFPEIIM
PGDVRNDIYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGDEAISEYKS
VIYYQVKQPRWFETVKVAIPIEDVNRSHLRFTFRHRSSQDSKDKSEKIFALAFVKLMRYD
GTTLRDGEHDLIVYKAEAKKLEDAATYLSLPSTKAELEEKGHSATGKSMQSLGSCTISKD
SFQISTLVCSTKLTQNVDLLGLLKWRSNTSLLQQNLRQLMKVDGGEVVKFLQDTLDALFN
IMMENSESETFDTLVFDALVFIIGLIADRKFQHFNPVLETYIKKHFSATLAYTKLTKVLK
NYVDGAEKPGVNEQLYKAMKALESIFKFIVRSRILFNQLYENKGEADFVESLLQLFRSIN
DMMSSMSDQTVRVKGAALKYLPTIVNDVKLVFDPKELSKMFTEFILNVPMGLLTIQKLYC
LIEIVHSDLFTQHDCREILLPMMTDQLKYHLERQEDLEACCQLLSHILEVLYRKDVGPTQ
RHVQIIMEKLLRTVNRTVISMGRDSELIGNFVACMTAILRQMEDYHYAHLIKTFGKMRTD
VVDFLMETFIMFKNLIGKNVYPFDWVIMNMVQNKVFLRAINQYADMLNKKFLDQANFELQ
LWNNYFHLAVAFLTQESLQLENFSSAKRAKILNKYGDMRRQIGFEIRDMWYNLGQHKIKF
IPEMVGPILEMTLIPETELRKATIPIFFDMMQCEFHSTRSFQMFENEIITKLDHEVEGGR
GDEQYKVLFDKILLEHCRKHKYLAKTGETFVKLVVRLMERLLDYRTIMHDENKENRMSCT
VNVLNFYKEIEREEMYIRYLYKLCDLHKECDNYTEAAYTLLLHAKLLKWSEDVCVAHLTQ
RDGYQATTQGQLKEQLYQEIIHYFDKGKMWEEAIALGKELAEQYENEMFDYEQLSELLKK
QAQFYENIVKVIRPKPDYFAVGYYGQGFPTFLRGKVFIYRGKEYERREDFEARLLTQFPN
AEKMKTTSPPGDDIKNSPGQYIQCFTVKPKLDLPPKFHRPVSEQIVSFYRVNEVQRFEYS
RPIRKGEKNPDNEFANMWIERTIYTTAYKLPGILRWFEVKSVFMVEISPLENAIETMQLT
NDKINSMVQQHLDDPSLPINPLSMLLNGIVDPAVMGGFANYEKAFFTDRYLQEHPEAHEK
IEKLKDLIAWQIPFLAEGIRIHGDKVTEALRPFHERMEACFKQLKEKVEKEYGVRIMPSS
LDDRRGSRPRSMVRSFTMPSSSRPLSVASVSSLSSDSTPSRPGSDGFALEPLLPKKMHSR
SQDKLDKDDLEKEKKDKKKEKRNSKHQEIFEKEFKPTDISLQQSEAVILSETISPLRPQR
PKSQVMNVIGSERRFSVSPSSPSSQQTPPPVTPRAKLSFSMQSSLELNGMTGADVADVPP
PLPLKGSVADYGNLMENQDLLGSPTPPPPPPHQRHLPPPLPSKTPPPPPPKTTRKQASVD
SGIVQ
GenBank ID Protein 122889127
UniProtKB/Swiss-Prot ID Q14185
UniProtKB/Swiss-Prot Entry Name DOCK1_HUMAN
PDB IDs Not Available
GenBank Gene ID AL157711
GeneCard ID DOCK1
GenAtlas ID DOCK1
HGNC ID HGNC:2987
References
General References
  1. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  2. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
  3. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  4. Heibeck TH, Ding SJ, Opresko LK, Zhao R, Schepmoes AA, Yang F, Tolmachev AV, Monroe ME, Camp DG 2nd, Smith RD, Wiley HS, Qian WJ: An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells. J Proteome Res. 2009 Aug;8(8):3852-61. doi: 10.1021/pr900044c. [PubMed:19534553 ]
  5. Brugnera E, Haney L, Grimsley C, Lu M, Walk SF, Tosello-Trampont AC, Macara IG, Madhani H, Fink GR, Ravichandran KS: Unconventional Rac-GEF activity is mediated through the Dock180-ELMO complex. Nat Cell Biol. 2002 Aug;4(8):574-82. [PubMed:12134158 ]
  6. Cote JF, Vuori K: Identification of an evolutionarily conserved superfamily of DOCK180-related proteins with guanine nucleotide exchange activity. J Cell Sci. 2002 Dec 15;115(Pt 24):4901-13. [PubMed:12432077 ]
  7. Hasegawa H, Kiyokawa E, Tanaka S, Nagashima K, Gotoh N, Shibuya M, Kurata T, Matsuda M: DOCK180, a major CRK-binding protein, alters cell morphology upon translocation to the cell membrane. Mol Cell Biol. 1996 Apr;16(4):1770-6. [PubMed:8657152 ]
  8. Matsuda M, Ota S, Tanimura R, Nakamura H, Matuoka K, Takenawa T, Nagashima K, Kurata T: Interaction between the amino-terminal SH3 domain of CRK and its natural target proteins. J Biol Chem. 1996 Jun 14;271(24):14468-72. [PubMed:8662907 ]
  9. Kiyokawa E, Hashimoto Y, Kobayashi S, Sugimura H, Kurata T, Matsuda M: Activation of Rac1 by a Crk SH3-binding protein, DOCK180. Genes Dev. 1998 Nov 1;12(21):3331-6. [PubMed:9808620 ]
  10. Tu Y, Kucik DF, Wu C: Identification and kinetic analysis of the interaction between Nck-2 and DOCK180. FEBS Lett. 2001 Mar 2;491(3):193-9. [PubMed:11240126 ]
  11. Kobayashi S, Shirai T, Kiyokawa E, Mochizuki N, Matsuda M, Fukui Y: Membrane recruitment of DOCK180 by binding to PtdIns(3,4,5)P3. Biochem J. 2001 Feb 15;354(Pt 1):73-8. [PubMed:11171081 ]