You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08435
Secondary Accession Numbers
  • 14147
Name Golgin subfamily A member 2
Synonyms
  1. 130 kDa cis-Golgi matrix protein
  2. GM130
  3. GM130 autoantigen
  4. Golgin-95
Gene Name GOLGA2
Protein Type Unknown
Biological Properties
General Function Replication, recombination and repair
Specific Function Golgi auto-antigen; probably involved in maintaining cis-Golgi structure
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Peripheral membrane protein
  2. Golgi apparatus
  3. Golgi stack membrane
Gene Properties
Chromosome Location Chromosome:9
Locus 9q34.11
SNPs GOLGA2
Gene Sequence
>3009 bp
ATGTGGCCCCAACCCCGCCTCCCTCCCCGCCCCGCGATGTCGGAAGAAACCCGACAGAGC
AAATTGGCCGCAGCGAAGAAAAAGTTGAGAGAATATCAGCAGAGGAATAGCCCTGGTGTT
CCTACAGGAGCGAAAAAGAAGAAGAAAATAAAAAATGGCAGTAACCCTGAGACAACCACT
TCTGGTGGTTGCCACTCACCTGAGGATACACCCAAGGACAATGCTGCTACTCTACAACCA
TCTGATGACACCGTGTTACCTGGCGGTGTCCCTTCCCCTGGTGCCAGTCTCACTAGCATG
GCGGCATCTCAGAATCATGATGCTGACAATGTCCCTAATCTCATGGATGAAACCAAGACT
TTCTCATCAACCGAGAGCCTGCGACAACTCTCCCAACAGCTCAATGGTCTTGTTTGTGAG
TCTGCGACATGTGTCAATGGGGAGGGCCCTGCATCGTCTGCTAACCTGAAGGATCTGGAG
AGCCGGTACCAACAGCTAGCGGTAGCCCTGGACTCCAGCTATGTAACAAACAAACAACTC
AATATCACGATAGAGAAATTGAAACAACAGAACCAAGAAATTACGGATCAGTTGGAAGAA
GAAAAGAAAGAATGCCACCAAAAGCAGGGAGCCCTAAGGGAGCAGTTACAGGTTCACATT
CAGACCATAGGGATCCTCGTATCAGAGAAAGCTGAGTTACAGACAGCCCTGGCTCACACT
CAGCATGCTGCCAGGCAGAAAGAAGGAGAGTCTGAAGATCTGGCCAGCCGCCTGCAGTAT
TCCCGGCGGCGTGTGGGAGAGTTGGAGCGGGCTCTCTCTGCTGTCTCCACGCAGCAGAAG
AAGGCAGACAGGTACAACAAGGAGTTAACCAAAGAGAGAGACGCCCTCAGGCTGGAGTTA
TACAAGAACACCCAAAGCAATGAGGACCTGAAGCAAGAGAAATCAGAATTGGAAGAGAAG
CTTCGGGTCCTAGTGACTGAGAAGGCTGGCATGCAGCTTAACTTGGAAGAATTGCAAAAG
AAGTTAGAGATGACGGAACTCCTGCTTCAACAGTTTTCAAGCCGGTGTGAAGCCCCTGAT
GCTAACCAGCAGTTACAGCAGGCCATGGAGGAGCGGGCACAGCTGGAAGCACACCTGGGG
CAGGTAATGGAGTCGGTTAGACAACTACAAATGGAGAGAGATAAATATGCGGAGAATCTC
AAAGGAGAGAGCGCCATGTGGCGGCAGAGGATGCAGCAGATGTCAGAGCAGGTGCACACA
TTGAGAGAGGAGAAGGAATGTAGCATGAGTCGGGTACAGGAGCTGGAGACGAGCTTGGCT
GAACTGAGGAACCAGATGGCTGAACCCCCGCCCCCAGAGCCCCCAGCAGGGCCCTCCGAG
GTGGAGCAGCAGCTACAAGCGGAGGCTGAGCACCTGCGGAAGGAGCTGGAGGGTCTGGCA
GGACAGCTTCAAGCCCAGGTGCAAGACAATGAGGGCTTGAGTCGCCTGAACCGGGAGCAG
GAGGAGAGGCTGCTGGAGCTGGAGCGGGCGGCCGAGCTCTGGGGGGAGCAGGCGGAGGCG
CGCAGGCAAATCCTGGAGACCATGCAGAACGACCGCACTACCATCAGCCGCGCACTCTCC
CAGAACCGGGAGCTCAAGGAGCAGCTGGCTGAGCTGCAGAGCGGATTTGTAAAGCTGACT
AATGAGAACATGGAGATCACCAGCGCACTGCAGTCGGAGCAGCACGTCAAGAGGGAGCTG
GGAAAGAAGCTGGGCGAGCTGCAGGAGAAGCTGAGCGAGCTGAAGGAAACGGTGGAGCTG
AAGAGCCAAGAGGCTCAAAGTCTGCAGCAGCAGCGAGACCAGTACCTGGGACACCTGCAG
CAGTATGTGGCCGCCTATCAGCAGCTGACCTCTGAGAAGGAGGTGCTGCATAATCAGCTA
CTGCTGCAGACCCAGCTCGTGGACCAGCTGCAGCAGCAGGAAGCTCAGGGCAAAGCGGTG
GCCGAGATGGCCCGCCAAGAGTTGCAGGAAACCCAGGAGCGCCTGGAAGCTGCCACCCAG
CAGAATCAGCAGCTACGGGCCCAGTTGAGCCTCATGGCTCACCCTGGGGAAGGAGATGGA
CTGGACCGGGAGGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGGCGGTGGCAGTACCT
CAGCCCATGCCAAGCATCCCGGAGGACCTGGAGAGCCGGGAAGCCATGGTGGCATTTTTC
AACTCAGCTGTAGCCAGTGCCGAGGAGGAGCAGGCAAGGCTACGTGGGCAGCTGAAGGAG
CAAAGGGTGCGCTGCCGGCGCCTGGCTCACCTGCTGGCCTCGGCCCAGAAGGAGCCTGAG
GCAGCAGCCCCAGCCCCAGGGACCGGGGGTGATTCTGTGTGTGGGGAGACCCACCGGGCC
CTGCAGGGGGCCATGGAGAAGCTGCAGAGCCGCTTTATGGAGCTCATGCAGGAGAAGGCA
GACCTGAAGGAGAGGGTAGAGGAACTGGAACATCGCTGCATCCAGCTTTCTGGAGAGACA
GACACCATTGGAGAGTACATTGCACTGTACCAGAGCCAGAGGGCAGTGCTGAAGGAGCGG
CACCGGGAGAAGGAGGAGTACATCAGCAGGCTGGCCCAAGACAAGGAGGAGATGAAGGTG
AAGCTGCTGGAGCTGCAGGAGCTGGTCTTACGGCTTGTGGGCGACCGCAACGAGTGGCAT
GGCAGATTCCTGGCAGCTGCCCAGAACCCTGCTGATGAGCCCACTTCAGGGGCCCCAGCC
CCCCAGGAACTTGGGGCTGCCAACCAGCAGGGTGATCTTTGCGAGGTGAGCCTCGCCGGC
AGTGTGGAGCCTGCCCAAGGAGAGGCCAGGGAGGGTTCTCCCCGTGACAACCCCACTGCA
CAGCAGATCATGCAGCTGCTTCGTGAGATGCAGAACCCCCGGGAGCGCCCAGGCTTGGGC
AGCAACCCCTGCATTCCTTTTTTTTACCGGGCTGACGAGAATGATGAGGTGAAGATCACT
GTCATCTAA
Protein Properties
Number of Residues 1002
Molecular Weight 113085.5
Theoretical pI 4.7
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Golgin subfamily A member 2
MWPQPRLPPRPAMSEETRQSKLAAAKKKLREYQQRNSPGVPTGAKKKKKIKNGSNPETTT
SGGCHSPEDTPKDNAATLQPSDDTVLPGGVPSPGASLTSMAASQNHDADNVPNLMDETKT
FSSTESLRQLSQQLNGLVCESATCVNGEGPASSANLKDLESRYQQLAVALDSSYVTNKQL
NITIEKLKQQNQEITDQLEEEKKECHQKQGALREQLQVHIQTIGILVSEKAELQTALAHT
QHAARQKEGESEDLASRLQYSRRRVGELERALSAVSTQQKKADRYNKELTKERDALRLEL
YKNTQSNEDLKQEKSELEEKLRVLVTEKAGMQLNLEELQKKLEMTELLLQQFSSRCEAPD
ANQQLQQAMEERAQLEAHLGQVMESVRQLQMERDKYAENLKGESAMWRQRMQQMSEQVHT
LREEKECSMSRVQELETSLAELRNQMAEPPPPEPPAGPSEVEQQLQAEAEHLRKELEGLA
GQLQAQVQDNEGLSRLNREQEERLLELERAAELWGEQAEARRQILETMQNDRTTISRALS
QNRELKEQLAELQSGFVKLTNENMEITSALQSEQHVKRELGKKLGELQEKLSELKETVEL
KSQEAQSLQQQRDQYLGHLQQYVAAYQQLTSEKEVLHNQLLLQTQLVDQLQQQEAQGKAV
AEMARQELQETQERLEAATQQNQQLRAQLSLMAHPGEGDGLDREEEEDEEEEEEEAVAVP
QPMPSIPEDLESREAMVAFFNSAVASAEEEQARLRGQLKEQRVRCRRLAHLLASAQKEPE
AAAPAPGTGGDSVCGETHRALQGAMEKLQSRFMELMQEKADLKERVEELEHRCIQLSGET
DTIGEYIALYQSQRAVLKERHREKEEYISRLAQDKEEMKVKLLELQELVLRLVGDRNEWH
GRFLAAAQNPADEPTSGAPAPQELGAANQQGDLCEVSLAGSVEPAQGEAREGSPRDNPTA
QQIMQLLREMQNPRERPGLGSNPCIPFFYRADENDEVKITVI
GenBank ID Protein 194097392
UniProtKB/Swiss-Prot ID Q08379
UniProtKB/Swiss-Prot Entry Name GOGA2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_004486.4
GeneCard ID GOLGA2
GenAtlas ID GOLGA2
HGNC ID HGNC:4425
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  5. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  6. Wang B, Malik R, Nigg EA, Korner R: Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. Anal Chem. 2008 Dec 15;80(24):9526-33. doi: 10.1021/ac801708p. [PubMed:19007248 ]
  7. Gevaert K, Staes A, Van Damme J, De Groot S, Hugelier K, Demol H, Martens L, Goethals M, Vandekerckhove J: Global phosphoproteome analysis on human HepG2 hepatocytes using reversed-phase diagonal LC. Proteomics. 2005 Sep;5(14):3589-99. [PubMed:16097034 ]
  8. Fritzler MJ, Hamel JC, Ochs RL, Chan EK: Molecular characterization of two human autoantigens: unique cDNAs encoding 95- and 160-kD proteins of a putative family in the Golgi complex. J Exp Med. 1993 Jul 1;178(1):49-62. [PubMed:8315394 ]
  9. Weide T, Bayer M, Koster M, Siebrasse JP, Peters R, Barnekow A: The Golgi matrix protein GM130: a specific interacting partner of the small GTPase rab1b. EMBO Rep. 2001 Apr;2(4):336-41. [PubMed:11306556 ]
  10. Chiu CF, Ghanekar Y, Frost L, Diao A, Morrison D, McKenzie E, Lowe M: ZFPL1, a novel ring finger protein required for cis-Golgi integrity and efficient ER-to-Golgi transport. EMBO J. 2008 Apr 9;27(7):934-47. doi: 10.1038/emboj.2008.40. Epub 2008 Mar 6. [PubMed:18323775 ]