You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08609
Secondary Accession Numbers
  • 14324
Name T-lymphoma invasion and metastasis-inducing protein 2
Synonyms
  1. SIF and TIAM1-like exchange factor
  2. TIAM-2
Gene Name TIAM2
Protein Type Unknown
Biological Properties
General Function Involved in Rho guanyl-nucleotide exchange factor activity
Specific Function Modulates the activity of RHO-like proteins and connects extracellular signals to cytoskeletal activities. Acts as a GDP- dissociation stimulator protein that stimulates the GDP-GTP exchange activity of RHO-like GTPases and activates them. Mediates extracellular laminin signals to activate Rac1, contributing to neurite growth. Involved in lamellipodial formation and advancement of the growth cone of embryonic hippocampal neurons. Promotes migration of neurons in the cerebral cortex. When overexpressed, induces membrane ruffling accompanied by the accumulation of actin filaments along the altered plasma membrane. Activates specifically RAC1, but not CDC42 and RHOA
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
small gtpase regulator activity
binding
ras guanyl-nucleotide exchange factor activity
rho guanyl-nucleotide exchange factor activity
receptor signaling protein activity
enzyme regulator activity
protein binding
molecular transducer activity
signal transducer activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
guanyl-nucleotide exchange factor activity
Process
regulation of ras protein signal transduction
regulation of rho protein signal transduction
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
intracellular signaling pathway
signaling
signaling pathway
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location
  1. Cytoplasm
  2. Cell projection
  3. Cell projection
  4. Cell projection
  5. lamellipodium
  6. growth cone
  7. filopodium
Gene Properties
Chromosome Location Chromosome:6
Locus 6q25.2
SNPs TIAM2
Gene Sequence
>5106 bp
ATGGGCAACTCCGACAGTCAGTACACCCTTCAAGGATCTAAAAATCATAGCAATACTATT
ACTGGTGCTAAGCAAATTCCTTGCTCCCTGAAAATACGTGGCATTCATGCAAAAGAGGAA
AAGTCATTGCATGGATGGGGTCACGGAAGCAACGGAGCAGGTTACAAGTCCAGGTCCCTG
GCCCGAAGCTGCCTTTCTCACTTTAAGAGTAACCAGCCTTACGCATCGAGACTCGGTGGC
CCCACATGCAAGGTCTCCAGAGGTGTTGCCTACTCCACGCACAGGACAAATGCCCCAGGG
AAGGATTTCCAGGGCATCAGTGCTGCTTTCTCAACTGAGAATGGCTTCCACTCTGTTGGC
CACGAGCTGGCAGATAACCACATCACCTCCAGAGACTGCAACGGACACCTTCTCAACTGC
TACGGGAGGAATGAGAGCATTGCCTCCACCCCACCGGGCGAAGACCGCAAGAGCCCCCGA
GTGCTCATCAAAACGCTGGGGAAGCTGGATGGGTGTTTAAGGGTCGAGTTCCACAATGGT
GGCAACCCCAGCAAAGTGCCTGCAGAGGACTGCAGTGAGCCGGTGCAGCTGCTGAGGTAC
TCACCTACCTTAGCATCGGAAACCTCCCCTGTGCCTGAAGCCAGGAGGGGGTCCAGCGCC
GATTCCCTGCCCAGCCATCGCCCCTCTCCCACGGACTCTCGCCTGCGGTCCAGCAAAGGC
AGCTCCCTGAGTTCTGAGTCATCCTGGTACGACTCCCCTTGGGGCAATGCTGGAGAGCTG
AGCGAGGCTGAGGGCTCCTTCCTGGCCCCCGGCATGCCTGACCCCAGTCTCCATGCCAGC
TTCCCACCTGGCGATGCCAAAAAGCCTTTCAACCAAAGCTCTTCCCTCTCCTCCCTCCGG
GAACTGTACAAAGATGCCAACCTGGGGAGCCTCTCCCCCTCAGGTATCCGCCTTTCTGAT
GAATACATGGGCACGCATGCCAGCCTGAGCAACCGTGTCTCTTTTGCTTCCGACATTGAT
GTGCCCTCCAGAGTGGCACACGGGGACCCCATCCAGTACAGTTCCTTCACTCTCCCCTGT
CGGAAGCCCAAAGCCTTTGTTGAGGATACTGCGAAGAAGGACTCCCTCAAAGCCAGGATG
CGACGGATCAGTGACTGGACGGGAAGCCTCTCAAGGAAGAAAAGGAAACTCCAGGAGCCG
AGGTCCAAGGAGGGCAGTGACTACTTTGACAGTCGCTCTGATGGACTGAATACAGATGTG
CAGGGATCCTCCCAGGCATCTGCTTTTCTGTGGTCAGGGGGCTCTACTCAGATCCTGTCT
CAGAGAAGTGAATCCACACATGCGATTGGCAGCGATCCCCTCCGGCAGAACATTTATGAG
AATTTCATGCGAGAGTTGGAAATGAGCAGGACCAACACTGAGAACATAGAAACATCTACA
GAAACCGCCGAGTCCAGCAGCGAGTCACTCAGCTCTCTGGAACAGCTGGATCTGCTCTTT
GAGAAGGAACAGGGGGTGGTCCGGAAGGCCGGGTGGCTCTTCTTCAAGCCCCTGGTCACT
GTGCAGAAGGAAAGGAAGCTTGAGCTGGTGGCACGAAGGAAATGGAAACAGTACTGGGTA
ACGCTGAAAGGATGCACGCTGCTGTTTTATGAGACCTATGGGAAGAATTCCATGGATCAG
AGCAGTGCCCCTCGGTGTGCTCTGTTTGCAGAAGACAGCATAGTGCAGTCTGTTCCAGAG
CATCCCAAGAAAGAAAATGTGTTCTGCCTCAGCAACTCCTTTGGAGATGTCTACCTTTTC
CAGGCCACCAGCCAGACAGATCTAGAAAACTGGGTCACTGCTGTACACTCTGCTTGTGCA
TCCCTTTTTGCAAAGAAGCATGGGAAAGAGGACACGCTGCGGCTGCTGAAGAACCAGACC
AAAAACCTGCTTCAGAAGATAGACATGGACAGCAAGATGAAGAAGATGGCAGAGCTGCAG
CTGTCCGTGGTGAGCGACCCAAAGAACAGGAAAGCCATAGAGAACCAGATCCAGCAATGG
GAGCAGAATCTTGAGAAATTTCACATGGATCTGTTCAGGATGCGCTGCTATCTGGCCAGC
CTACAAGGTGGGGAGTTACCGAACCCAAAGAGTCTCCTTGCAGCCGCCAGCCGCCCCTCC
AAGCTGGCCCTCGGCAGGCTGGGCATCTTGTCTGTTTCCTCTTTCCATGCTCTGGTATGT
TCTAGAGATGACTCTGCTCTCCGGAAAAGGACACTGTCACTGACCCAGCGAGGGAGAAAC
AAGAAGGGAATATTTTCTTCGTTAAAAGGGCTGGACACACTGGCCAGAAAAGGCAAGGAG
AAGAGACCTTCTATAACTCAGGTCGATGAACTTCTGCATATATATGGTTCAACAGTAGAC
GGTGTTCCCCGAGACAATGCATGGGAAATCCAGACTTATGTCCACTTTCAGGACAATCAC
GGAGTTACTGTAGGGATCAAGCCAGAGCACAGAGTAGAAGATATTTTGACTTTGGCATGC
AAGATGAGGCAGTTGGAACCCAGCCATTATGGCCTACAGCTTCGAAAATTAGTAGATGAC
AATGTTGAGTATTGCATCCCTGCACCATATGAATATATGCAACAACAGGTTTATGATGAA
ATAGAAGTCTTTCCACTAAATGTTTATGACGTGCAGCTCACGAAGACTGGGAGTGTGTGT
GACTTTGGGTTTGCAGTTACAGCGCAGGTGGATGAGCGTCAGCATCTCAGCCGGATATTT
ATAAGCGACGTTCTTCCCGATGGCCTGGCGTATGGGGAAGGGCTGAGAAAGGGCAATGAG
ATCATGACCTTAAATGGGGAAGCTGTGTCTGATCTTGACCTTAAGCAGATGGAGGCCCTG
TTTTCTGAGAAGAGCGTCGGACTCACTCTGATTGCCCGGCCTCCGGACACAAAAGCAACC
CTGTGTACATCCTGGTCAGACAGTGACCTGTTCTCCAGGGACCAGAAGAGTCTGCTGCCC
CCTCCTAACCAGTCCCAACTGCTGGAGGAATTCCTGGATAACTTTAAAAAGAATACAGCC
AATGATTTCAGCAACGTCCCTGATATCACAACAGGTCTGAAAAGGAGTCAGACAGATGGC
ACTCTGGATCAGGTTTCCCACAGGGAGAAAATGGAGCAGACATTCAGGAGTGCTGAGCAG
ATCACTGCACTGTGCAGGAGTTTTAACGACAGTCAGGCCAACGGCATGGAAGGACCGCGG
GAGAATCAGGATCCTCCTCCGAGGCCTCTGGCCCGCCACCTGTCTGATGCAGACCGCCTC
CGCAAAGTCATCCAGGAGCTTGTGGACACAGAGAAGTCCTACGTGAAGGATTTGAGCTGC
CTCTTTGAATTATACTTGGAGCCACTTCAGAATGAGACCTTTCTTACCCAAGATGAGATG
GAGTCACTTTTTGGAAGTTTGCCAGAGATGCTTGAGTTTCAGAAGGTGTTTCTGGAGACC
CTGGAGGATGGGATTTCAGCATCATCTGACTTTAACACCCTAGAAACCCCCTCACAGTTT
AGAAAATTACTGTTTTCCCTTGGAGGCTCTTTCCTTTATTACGCGGACCACTTTAAACTG
TACAGTGGATTCTGTGCTAACCATATCAAAGTACAGAAGGTTCTGGAGCGAGCTAAAACT
GACAAAGCCTTCAAGGCTTTTCTGGACGCCCGGAACCCCACCAAGCAGCATTCCTCCACG
CTGGAGTCCTACCTCATCAAGCCGGTTCAGAGAGTGCTCAAGTACCCGCTGCTGCTCAAG
GAGCTGGTGTCCCTGACGGACCAGGAGAGCGAGGAGCACTACCACCTGACGGAAGCACTA
AAGGCAATGGAGAAAGTAGCGAGCCACATCAATGAGATGCAGAAGATCTATGAGGATTAT
GGGACCGTGTTTGACCAGCTAGTAGCTGAGCAGAGCGGAACAGAGAAGGAGGTAACAGAA
CTTTCGATGGGAGAGCTTCTGATGCACTCTACGGTTTCCTGGTTGAATCCATTTCTGTCT
CTAGGAAAAGCTAGAAAGGACCTTGAGCTCACAGTATTTGTTTTTAAGAGAGCCGTCATA
CTGGTTTATAAAGAAAACTGCAAACTGAAAAAGAAATTGCCCTCGAATTCCCGGCCTGCA
CACAACTCTACTGACTTGGACCCATTTAAATTCCGCTGGTTGATCCCCATCTCCGCGCTT
CAAGTCAGACTGGGGAATCCAGCAGGGACAGAAAATAATTCCATATGGGAACTGATCCAT
ACGAAGTCAGAAATAGAAGGACGGCCAGAAACCATCTTTCAGTTGTGTTGCAGTGACAGT
GAAAGCAAAACCAACATTGTTAAGGTGATTCGTTCTATTCTGAGGGAGAACTTCAGGCGT
CACATAAAGTGTGAATTACCACTGGAGAAAACGTGTAAGGATCGCCTGGTACCTCTTAAG
AACCGAGTTCCTGTTTCGGCCAAATTAGCTTCATCCAGGTCTTTAAAAGTCCTGAAGAAT
TCCTCCAGCAACGAGTGGACCGGTGAGACTGGCAAGGGAACCTTGCTGGACTCTGACGAG
GGCAGCTTGAGCAGCGGCACCCAGAGCAGCGGCTGCCCCACGGCTGAGGGCAGGCAGGAC
TCCAAGAGCACTTCTCCCGGGAAATACCCACACCCCGGCTTGGCAGATTTTGCCGACAAT
CTCATCAAAGAGAGTGACATCCTGAGCGATGAAGATGATGACCACCGTCAGACTGTGAAG
CAGGGCAGCCCTACTAAAGACATCGAAATTCAGTTCCAGAGACTGAGGATTTCCGAGGAC
CCAGACGTTCACCCCGAGGCTGAGCAGCAGCCTGGCCCGGAGTCGGGTGAGGGTCAGAAA
GGAGGAGAGCAGCCCAAACTGGTCCGGGGGCACTTCTGCCCCATTAAACGAAAAGCCAAC
AGCACCAAGAGGGACAGAGGAACTTTGCTCAAGGCGCAGATCCGTCACCAGTCCCTTGAC
AGTCAGTCTGAAAATGCCACCATCGACCTAAATTCTGTTCTAGAGCGAGAATTCAGTGTC
CAGAGTTTAACATCTGTTGTCAGTGAGGAGTGTTTTTATGAAACAGAGAGCCACGGAAAA
TCATAG
Protein Properties
Number of Residues 1701
Molecular Weight 190101.0
Theoretical pI 7.21
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>T-lymphoma invasion and metastasis-inducing protein 2
MGNSDSQYTLQGSKNHSNTITGAKQIPCSLKIRGIHAKEEKSLHGWGHGSNGAGYKSRSL
ARSCLSHFKSNQPYASRLGGPTCKVSRGVAYSTHRTNAPGKDFQGISAAFSTENGFHSVG
HELADNHITSRDCNGHLLNCYGRNESIASTPPGEDRKSPRVLIKTLGKLDGCLRVEFHNG
GNPSKVPAEDCSEPVQLLRYSPTLASETSPVPEARRGSSADSLPSHRPSPTDSRLRSSKG
SSLSSESSWYDSPWGNAGELSEAEGSFLAPGMPDPSLHASFPPGDAKKPFNQSSSLSSLR
ELYKDANLGSLSPSGIRLSDEYMGTHASLSNRVSFASDIDVPSRVAHGDPIQYSSFTLPC
RKPKAFVEDTAKKDSLKARMRRISDWTGSLSRKKRKLQEPRSKEGSDYFDSRSDGLNTDV
QGSSQASAFLWSGGSTQILSQRSESTHAIGSDPLRQNIYENFMRELEMSRTNTENIETST
ETAESSSESLSSLEQLDLLFEKEQGVVRKAGWLFFKPLVTVQKERKLELVARRKWKQYWV
TLKGCTLLFYETYGKNSMDQSSAPRCALFAEDSIVQSVPEHPKKENVFCLSNSFGDVYLF
QATSQTDLENWVTAVHSACASLFAKKHGKEDTLRLLKNQTKNLLQKIDMDSKMKKMAELQ
LSVVSDPKNRKAIENQIQQWEQNLEKFHMDLFRMRCYLASLQGGELPNPKSLLAAASRPS
KLALGRLGILSVSSFHALVCSRDDSALRKRTLSLTQRGRNKKGIFSSLKGLDTLARKGKE
KRPSITQVDELLHIYGSTVDGVPRDNAWEIQTYVHFQDNHGVTVGIKPEHRVEDILTLAC
KMRQLEPSHYGLQLRKLVDDNVEYCIPAPYEYMQQQVYDEIEVFPLNVYDVQLTKTGSVC
DFGFAVTAQVDERQHLSRIFISDVLPDGLAYGEGLRKGNEIMTLNGEAVSDLDLKQMEAL
FSEKSVGLTLIARPPDTKATLCTSWSDSDLFSRDQKSLLPPPNQSQLLEEFLDNFKKNTA
NDFSNVPDITTGLKRSQTDGTLDQVSHREKMEQTFRSAEQITALCRSFNDSQANGMEGPR
ENQDPPPRSLARHLSDADRLRKVIQELVDTEKSYVKDLSCLFELYLEPLQNETFLTQDEM
ESLFGSLPEMLEFQKVFLETLEDGISASSDFNTLETPSQFRKLLFSLGGSFLYYADHFKL
YSGFCANHIKVQKVLERAKTDKAFKAFLDARNPTKQHSSTLESYLIKPVQRVLKYPLLLK
ELVSLTDQESEEHYHLTEALKAMEKVASHINEMQKIYEDYGTVFDQLVAEQSGTEKEVTE
LSMGELLMHSTVSWLNPFLSLGKARKDLELTVFVFKRAVILVYKENCKLKKKLPSNSRPA
HNSTDLDPFKFRWLIPISALQVRLGNPAGTENNSIWELIHTKSEIEGRPETIFQLCCSDS
ESKTNIVKVIRSILRENFRRHIKCELPLEKTCKDRLVPLKNRVPVSAKLASSRSLKVLKN
SSSNEWTGETGKGTLLDSDEGSLSSGTQSSGCPTAEGRQDSKSTSPGKYPHPGLADFADN
LIKESDILSDEDDDHRQTVKQGSPTKDIEIQFQRLRISEDPDVHPEAEQQPGPESGEGQK
GGEQPKLVRGHFCPIKRKANSTKRDRGTLLKAQIRHQSLDSQSENATIDLNSVLEREFSV
QSLTSVVSEECFYETESHGKS
GenBank ID Protein 58331187
UniProtKB/Swiss-Prot ID Q8IVF5
UniProtKB/Swiss-Prot Entry Name TIAM2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_012454.3
GeneCard ID TIAM2
GenAtlas ID TIAM2
HGNC ID HGNC:11806
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  5. Chiu CY, Leng S, Martin KA, Kim E, Gorman S, Duhl DM: Cloning and characterization of T-cell lymphoma invasion and metastasis 2 (TIAM2), a novel guanine nucleotide exchange factor related to TIAM1. Genomics. 1999 Oct 1;61(1):66-73. [PubMed:10512681 ]