You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08685
Secondary Accession Numbers
  • 14406
Name Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
Synonyms
  1. PP2A-beta
Gene Name PPP2CB
Protein Type Unknown
Biological Properties
General Function Involved in hydrolase activity
Specific Function PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase.
Pathways
  • Chagas disease (American trypanosomiasis)
  • Dopaminergic synapse
  • Hepatitis C
  • Hippo signaling pathway
  • Long-term depression
  • mRNA surveillance pathway
  • Oocyte meiosis
  • PI3K-Akt signaling pathway
  • TGF-beta signaling pathway
  • Tight junction
Reactions
A phosphoprotein + Water → a protein + Phosphoric acid details
GO Classification
Biological Process
negative regulation of apoptotic process
response to antibiotic
negative regulation of Ras protein signal transduction
regulation of gene expression
proteasomal ubiquitin-dependent protein catabolic process
response to hydrogen peroxide
fibroblast growth factor receptor signaling pathway
protein dephosphorylation
Cellular Component
cytosol
nucleus
chromosome, centromeric region
protein phosphatase type 2A complex
spindle pole
Function
catalytic activity
hydrolase activity
Molecular Function
protein serine/threonine phosphatase activity
metal ion binding
Cellular Location
  1. Nucleus
  2. Cytoplasm
  3. Cytoplasm
  4. cytoskeleton
  5. Chromosome
  6. centromere
  7. spindle pole
Gene Properties
Chromosome Location 8
Locus 8p12
SNPs PPP2CB
Gene Sequence
>930 bp
ATGGACGACAAGGCGTTCACCAAGGAGCTGGACCAGTGGGTCGAGCAGCTGAACGAGTGT
AAGCAGCTGAACGAGAACCAAGTGCGGACGCTGTGCGAGAAGGCAAAGGAAATTTTAACA
AAAGAATCAAATGTGCAAGAGGTTCGTTGCCCTGTTACTGTCTGTGGAGATGTGCATGGT
CAATTTCATGATCTTATGGAACTCTTTAGAATTGGTGGAAAATCACCGGATACAAACTAC
TTATTCATGGGTGACTATGTAGACAGAGGATATTATTCAGTGGAGACTGTGACTCTTCTT
GTAGCATTAAAGGTGCGTTATCCAGAACGCATTACAATATTGAGAGGAAATCACGAAAGC
CGACAAATTACCCAAGTATATGGCTTTTATGATGAATGTCTGCGAAAGTATGGGAATGCC
AACGTTTGGAAATATTTTACAGATCTCTTTGATTATCTTCCACTTACAGCTTTAGTAGAT
GGACAGATATTCTGCCTCCATGGTGGCCTCTCTCCATCCATAGACACACTGGATCATATA
AGAGCCCTGGATCGTTTACAGGAAGTTCCACATGAGGGCCCAATGTGTGATCTGTTATGG
TCAGATCCAGATGATCGTGGTGGATGGGGTATTTCACCACGTGGTGCTGGCTACACATTT
GGACAAGACATTTCTGAAACCTTTAACCATGCCAATGGTCTCACACTGGTTTCTCGTGCC
CACCAGCTTGTAATGGAGGGATACAATTGGTGTCATGATCGGAATGTGGTTACCATTTTC
AGTGCACCCAATTACTGTTATCGTTGTGGGAACCAGGCTGCTATCATGGAATTAGATGAC
ACTTTAAAATATTCCTTCCTTCAATTTGACCCGGCGCCTCGTCGTGGTGAGCCTCATGTT
ACACGGCGCACCCCAGACTACTTCCTATAA
Protein Properties
Number of Residues 309
Molecular Weight 35574.85
Theoretical pI 5.426
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
GenBank ID Protein 35581
UniProtKB/Swiss-Prot ID P62714
UniProtKB/Swiss-Prot Entry Name PP2AB_HUMAN
PDB IDs Not Available
GenBank Gene ID X12656
GeneCard ID PPP2CB
GenAtlas ID PPP2CB
HGNC ID HGNC:9300
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Ogris E, Du X, Nelson KC, Mak EK, Yu XX, Lane WS, Pallas DC: A protein phosphatase methylesterase (PME-1) is one of several novel proteins stably associating with two inactive mutants of protein phosphatase 2A. J Biol Chem. 1999 May 14;274(20):14382-91. [PubMed:10318862 ]
  3. Arino J, Woon CW, Brautigan DL, Miller TB Jr, Johnson GL: Human liver phosphatase 2A: cDNA and amino acid sequence of two catalytic subunit isotypes. Proc Natl Acad Sci U S A. 1988 Jun;85(12):4252-6. [PubMed:2837763 ]
  4. Khew-Goodall Y, Mayer RE, Maurer F, Stone SR, Hemmings BA: Structure and transcriptional regulation of protein phosphatase 2A catalytic subunit genes. Biochemistry. 1991 Jan 8;30(1):89-97. [PubMed:1846293 ]
  5. Favre B, Zolnierowicz S, Turowski P, Hemmings BA: The catalytic subunit of protein phosphatase 2A is carboxyl-methylated in vivo. J Biol Chem. 1994 Jun 10;269(23):16311-7. [PubMed:8206937 ]
  6. Virshup DM, Kauffman MG, Kelly TJ: Activation of SV40 DNA replication in vitro by cellular protein phosphatase 2A. EMBO J. 1989 Dec 1;8(12):3891-8. [PubMed:2555176 ]
  7. Kitajima TS, Sakuno T, Ishiguro K, Iemura S, Natsume T, Kawashima SA, Watanabe Y: Shugoshin collaborates with protein phosphatase 2A to protect cohesin. Nature. 2006 May 4;441(7089):46-52. Epub 2006 Mar 15. [PubMed:16541025 ]
  8. Hemmings BA, Wernet W, Mayer R, Maurer F, Hofsteenge J, Stone SR: The nucleotide sequence of the cDNA encoding the human lung protein phosphatase 2A beta catalytic subunit. Nucleic Acids Res. 1988 Dec 9;16(23):11366. [PubMed:2849765 ]
  9. Pallas DC, Shahrik LK, Martin BL, Jaspers S, Miller TB, Brautigan DL, Roberts TM: Polyoma small and middle T antigens and SV40 small t antigen form stable complexes with protein phosphatase 2A. Cell. 1990 Jan 12;60(1):167-76. [PubMed:2153055 ]