You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08701
Secondary Accession Numbers
  • 14422
Name Acyl-coenzyme A synthetase ACSM3, mitochondrial
Synonyms
  1. Acyl-CoA synthetase medium-chain family member 3
  2. Butyrate--CoA ligase 3
  3. Butyryl-coenzyme A synthetase 3
  4. Middle-chain acyl-CoA synthetase 3
  5. Protein SA homolog
Gene Name ACSM3
Protein Type Unknown
Biological Properties
General Function Involved in catalytic activity
Specific Function Has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). Acts on acids from C(4) to C(11) and on the corresponding 3-hydroxy- and 2,3- or 3,4-unsaturated acids (in vitro) (By similarity).
Pathways
  • Butanoate metabolism
Reactions
Adenosine triphosphate + a carboxylate + Coenzyme A → Adenosine monophosphate + Pyrophosphate + an acyl-CoA details
Adenosine triphosphate + Butyric acid + Coenzyme A → Adenosine monophosphate + Pyrophosphate + Butyryl-CoA details
GO Classification
Biological Process
cholesterol homeostasis
regulation of blood pressure
fatty acid biosynthetic process
Cellular Component
mitochondrial matrix
Function
catalytic activity
Molecular Function
metal ion binding
ATP binding
butyrate-CoA ligase activity
fatty acid ligase activity
Process
metabolic process
Cellular Location
  1. Mitochondrion matrix
Gene Properties
Chromosome Location 16
Locus 16p13.11
SNPs ACSM3
Gene Sequence
>1761 bp
ATGCTAGCTCGTGTCACCAGGAAGATGCTACGTCATGCCAAGTGTTTTCAGCGCCTAGCA
ATTTTTGGTTCTGTGAGGGCACTGCATAAAGATAATAGAACAGCAACCCCTCAGAATTTC
TCCAACTATGAATCCATGAAACAGGACTTCAAACTGGGGATTCCAGAGTATTTCAACTTT
GCTAAAGATGTCCTGGACCAATGGACTGATAAGGAAAAGGCTGGAAAGAAACCTTCAAAT
CCAGCCTTCTGGTGGATCAACAGAAATGGAGAAGAGATGCGATGGAGTTTTGAGGAACTG
GGATCTCTGTCCAGAAAATTTGCCAATATACTTTCAGAAGCCTGTTCCCTACAAAGAGGA
GATCGGGTAATTCTGATTCTGCCCAGGGTCCCAGAGTGGTGGCTTGCAAATGTGGCCTGT
CTGCGAACAGGGACAGTTTTAATTCCAGGAACCACTCAGCTGACCCAGAAAGACATTCTC
TACAGACTACAATCTTCAAAAGCAAACTGCATTATCACCAATGATGTTTTAGCCCCAGCA
GTAGACGCTGTTGCATCCAAATGTGAAAATCTGCACTCCAAGCTGATTGTATCAGAGAAC
TCCAGAGAGGGGTGGGGGAACCTCAAGGAGTTGATGAAACATGCCAGTGACAGCCACACC
TGTGTGAAGACAAAACACAATGAGATCATGGCCATATTCTTTACCAGTGGAACAAGTGGA
TATCCGAAAATGACTGCACACACCCACAGCAGTTTTGGTTTAGGATTATCTGTAAATGGA
AGGTTCTGGCTAGATTTGACACCCTCAGATGTGATGTGGAATACCTCAGATACGGGCTGG
GCAAAGTCTGCATGGAGTAGTGTTTTTTCTCCGTGGATCCAGGGAGCATGTGTATTCACA
CACCATTTACCCCGTTTTGAGCCGACTTCTATCTTGCAAACACTCTCCAAGTACCCCATC
ACAGTCTTCTGTTCAGCACCAACTGTATACCGAATGCTTGTACAGAATGATATAACCAGC
TATAAGTTTAAAAGCTTAAAGCACTGTGTGAGTGCTGGGGAACCAATTACCCCTGACGTG
ACTGAAAAATGGAGAAACAAGACGGGCCTGGATATCTACGAAGGATATGGACAGACTGAA
ACGGTGCTAATCTGTGGAAATTTTAAGGGAATGAAAATTAAACCTGGCTCAATGGGAAAA
CCTTCTCCTGCTTTCGATGTTAAGATTGTAGATGTAAATGGCAATGTTCTACCTCCTGGA
CAAGAAGGAGATATTGGCATTCAAGTTCTACCCAACCGACCATTTGGCCTTTTTACTCAT
TACGTAGATAATCCTTCAAAAACAGCTTCAACTCTACGAGGCAATTTCTATATCACTGGG
GACAGAGGATATATGGATAAAGATGGGTATTTCTGGTTTGTTGCAAGAGCAGATGATGTC
ATATTATCCTCTGGCTATCGAATTGGACCATTTGAGGTAGAAAATGCCCTGAATGAACAC
CCTTCAGTTGCAGAGTCAGCTGTTGTCAGCAGCCCAGACCCCATCAGAGGAGAGGTAGTA
AAGGCTTTTGTCGTTCTAAATCCTGATTACAAGTCACATGATCAAGAACAACTAATAAAG
GAGATTCAGGAGCATGTTAAAAAAACTACAGCACCTTACAAATATCCCAGAAAGGTAGAA
TTTATTCAAGAGCTGCCAAAGACTATCAGTGGGAAGACAAAAAGAAATGAACTGAGGAAG
AAAGAATGGAAGACAATTTAA
Protein Properties
Number of Residues 586
Molecular Weight 66152.235
Theoretical pI 9.041
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Acyl-coenzyme A synthetase ACSM3, mitochondrial
MLARVTRKMLRHAKCFQRLAIFGSVRALHKDNRTATPQNFSNYESMKQDFKLGIPEYFNF
AKDVLDQWTDKEKAGKKPSNPAFWWINRNGEEMRWSFEELGSLSRKFANILSEACSLQRG
DRVILILPRVPEWWLANVACLRTGTVLIPGTTQLTQKDILYRLQSSKANCIITNDVLAPA
VDAVASKCENLHSKLIVSENSREGWGNLKELMKHASDSHTCVKTKHNEIMAIFFTSGTSG
YPKMTAHTHSSFGLGLSVNGRFWLDLTPSDVMWNTSDTGWAKSAWSSVFSPWIQGACVFT
HHLPRFEPTSILQTLSKYPITVFCSAPTVYRMLVQNDITSYKFKSLKHCVSAGEPITPDV
TEKWRNKTGLDIYEGYGQTETVLICGNFKGMKIKPGSMGKPSPAFDVKIVDVNGNVLPPG
QEGDIGIQVLPNRPFGLFTHYVDNPSKTASTLRGNFYITGDRGYMDKDGYFWFVARADDV
ILSSGYRIGPFEVENALNEHPSVAESAVVSSPDPIRGEVVKAFVVLNPDYKSHDQEQLIK
EIQEHVKKTTAPYKYPRKVEFIQELPKTISGKTKRNELRKKEWKTI
GenBank ID Protein 42544132
UniProtKB/Swiss-Prot ID Q53FZ2
UniProtKB/Swiss-Prot Entry Name ACSM3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_005622.3
GeneCard ID ACSM3
GenAtlas ID ACSM3
HGNC ID HGNC:10522
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Tang LY, Deng N, Wang LS, Dai J, Wang ZL, Jiang XS, Li SJ, Li L, Sheng QH, Wu DQ, Li L, Zeng R: Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction. Mol Cell Proteomics. 2007 Nov;6(11):1952-67. Epub 2007 Aug 12. [PubMed:17693683 ]
  3. Loftus BJ, Kim UJ, Sneddon VP, Kalush F, Brandon R, Fuhrmann J, Mason T, Crosby ML, Barnstead M, Cronin L, Deslattes Mays A, Cao Y, Xu RX, Kang HL, Mitchell S, Eichler EE, Harris PC, Venter JC, Adams MD: Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q. Genomics. 1999 Sep 15;60(3):295-308. [PubMed:10493829 ]
  4. Iwai N, Ohmichi N, Hanai K, Nakamura Y, Kinoshita M: Human SA gene locus as a candidate locus for essential hypertension. Hypertension. 1994 Mar;23(3):375-80. [PubMed:7907320 ]
  5. Nabika T, Bonnardeaux A, James M, Julier C, Jeunemaitre X, Corvol P, Lathrop M, Soubrier F: Evaluation of the SA locus in human hypertension. Hypertension. 1995 Jan;25(1):6-13. [PubMed:7843754 ]
  6. Telgmann R, Brand E, Nicaud V, Hagedorn C, Beining K, Schonfelder J, Brink-Spalink V, Schmidt-Petersen K, Matanis T, Vischer P, Nofer JR, Hasenkamp S, Plouin PF, Drouet L, Cambien F, Paul M, Tiret L, Brand-Herrmann SM: SAH gene variants are associated with obesity-related hypertension in Caucasians: the PEGASE Study. J Hypertens. 2007 Mar;25(3):557-64. [PubMed:17278971 ]