You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08849
Secondary Accession Numbers
  • 14576
Name PH domain leucine-rich repeat-containing protein phosphatase 2
Synonyms
  1. PH domain leucine-rich repeat-containing protein phosphatase-like
  2. PHLPP-like
Gene Name PHLPP2
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Protein phosphatase that mediates dephosphorylation of 'Ser-473' of AKT1, 'Ser-660' of PRKCB isoform beta-II and 'Ser-657' of PRKCA. AKT1 regulates the balance between cell survival and apoptosis through a cascade that primarily alters the function of transcription factors that regulate pro- and antiapoptotic genes. Dephosphorylation of 'Ser-473' of AKT1 triggers apoptosis and decreases cell proliferation. Also controls the phosphorylation of AKT3. Dephosphorylation of PRKCA and PRKCB leads to their destabilization and degradation. Inhibits cancer cell proliferation and may act as a tumor suppressor.
Pathways
  • PI3K-Akt signaling pathway
Reactions
A phosphoprotein + Water → a protein + Phosphoric acid details
GO Classification
Biological Process
metabolic process
Cellular Component
cytoplasm
nucleus
membrane
Function
binding
catalytic activity
protein binding
Molecular Function
phosphoprotein phosphatase activity
metal ion binding
Cellular Location
  1. Nucleus
  2. Cytoplasm
  3. Peripheral membrane protein
  4. Membrane
Gene Properties
Chromosome Location 16
Locus 16q22.2
SNPs PHLPP2
Gene Sequence
>3972 bp
ATGAAACGCAATGGGAGCAGAAATTGTTTGAATAGGAGAAGTAGGTTTGGTTCTCGAGAA
AGAGACTGGCTAAGAGAAGATGTAAAGAGAGGCTGTGTTTACCTTTATGGAGCAGACACT
ACCACTGCCACTACAACCACCACCACCTCCTCTTCCTCTTCCTCCTCCTCCTCTTCCTCT
GACTTACATCTCGTCCTTTGCACTGTAGAGACACCAGCATCAGAAATATGTGCTGGAGAG
GGAAGAGAAAGTCTTTATTTACAGCTTCATGGAGACCTGGTCAGGAGACTGGAACCTACT
GAACGACCTCTTCAGATCGTTTATGATTACTTATCCAGGCTGGGATTTGATGATCCTGTG
CGCATACAGGAGGAGGCTACAAATCCTGACCTCGGCTGTATGATTCGATTTTATGGTGAA
AAACCATGCCACATGGATCGTTTGGATCGAATCCTATTGTCTGGCATCTATAATGTACGC
AAGGGAAAGACCCAGCTGCATAAGTGGGCTGAGCGCCTAGTTGTCCTCTGTGGTACCTGC
CTTATCGTTTCCTCAGTGAAGGATTGTCAAACTGGAAAGATGCACATTTTGCCTCTGGTT
GGTGGAAAGATAGAAGAAGTGAAGCGACGGCAATACTCCCTTGCTTTCAGCTCAGCAGGA
GCCCAAGCTCAGACCTATCATGTCAGCTTCGAGACTTTGGCCGAGTACCAGCGATGGCAA
CGGCAAGCATCCAAGGTGGTGTCCCAGCGAATCAGTACCGTGGATCTCTCGTGTTACAGC
CTCGAGGAGGTTCCTGAGCATCTCTTCTATAGTCAAGATATTACCTACCTCAACTTGCGA
CACAACTTCATGCAGTTAGAAAGACCCGGAGGCCTCGATACACTCTACAAATTTTCTCAA
CTGAAGGGCCTGAACTTGTCCCATAATAAACTTGGGTTGTTTCCTATATTGTTATGCGAG
ATCTCTACCCTGACTGAGCTCAACCTTTCCTGTAATGGATTTCATGACCTACCAAGTCAA
ATTGGCAATCTGCTAAATCTTCAAACCCTCTGTCTTGATGGCAACTTTCTGACTACTTTA
CCTGAAGAATTGGGAAATCTACAACAGCTTTCCTCCTTGGGAATTTCCTTCAACAACTTT
AGTCAAATTCCTGAGGTTTATGAGAAACTCACTATGTTAGATAGAGTGGTTATGGCAGGA
AATTGCCTGGAAGTCCTGAACTTAGGGGTGCTGAATAGGATGAACCATATCAAGCATGTG
GATTTAAGGATGAACCATTTGAAAACCATGGTTATTGAAAATCTGGAGGGAAATAAACAC
ATCACCCACGTGGATCTGCGGGACAACCGACTGACTGACTTGGATCTTAGCTCCTTATGC
AGCTTGGAACAGCTGCACTGTGGGCGGAATCAGCTGAGGGAGCTAACACTCAGTGGCTTT
TCCCTTCGGACCCTCTATGCCAGTTCCAACAGGCTGACAGCAGTGAACGTCTATCCAGTA
CCCAGCCTGCTCACTTTCTTGGATCTCTCCCGAAACCTGCTAGAGTGTGTCCCTGACTGG
GCCTGTGAAGCAAAGAAGATAGAAGTATTAGATGTGAGCTATAATCTTCTCACAGAGGTT
CCCGTGAGAATTCTGAGTAGCTTGAGTCTTAGAAAACTGATGCTGGGACACAATCATGTG
CAAAACCTTCCAACACTGGTAGAGCACATCCCCCTCGAGGTGCTGGATCTTCAGCATAAT
GCACTCACGAGGCTGCCAGACACCCTCTTCTCCAAGGCCTTAAATCTCAGATACTTGAAT
GCATCTGCAAATAGTCTGGAGTCTTTACCATCCGCCTGCACTGGAGAGGAGAGTTTGAGT
ATGCTGCAGCTGCTTTATCTGACCAACAATCTCCTGACGGATCAGTGCATACCTGTCCTG
GTAGGGCACCTGCACCTGCGAATCTTGCACCTTGCAAACAATCAGTTACAGACCTTTCCT
GCAAGCAAACTAAATAAATTGGAGCAATTGGAGGAACTGAACCTAAGTGGCAACAAGCTT
AAAACCATTCCCACAACCATAGCAAACTGTAAAAGGCTGCACACCCTTGTTGCACACTCC
AACAACATCAGCATTTTCCCAGAAATACTGCAGTTGCCTCAGATCCAGTTTGTAGACCTA
AGTTGCAACGACTTGACAGAAATCCTGATTCCAGAGGCTTTGCCTGCTACATTACAAGAC
CTTGACCTGACTGGAAATACAAATCTGGTTCTGGAACACAAGACACTGGACATATTTAGC
CATATCACAACCCTGAAAATTGATCAGAAACCTTTGCCAACCACAGATTCTACAGTTACG
TCAACCTTCTGGAGCCATGGACTGGCTGAGATGGCAGGGCAGAGAAATAAGCTGTGTGTC
TCAGCACTTGCTATGGATAGCTTTGCAGAGGGGGTGGGAGCTGTGTATGGCATGTTTGAT
GGAGACCGAAATGAGGAGCTCCCGCGCCTGCTGCAGTGTACGATGGCAGATGTGCTTTTA
GAAGAGGTACAGCAGTCAACTAATGACACAGTTTTCATGGCTAACACCTTCTTGGTATCT
CACAGGAAATTAGGAATGGCTGGCCAGAAGTTGGGCTCCTCCGCTCTCCTGTGCTACATC
CGCCCTGACACTGCCGATCCAGCAAGTAGCTTTAGCTTGACTGTAGCCAATGTTGGCACG
TGCCAAGCAGTCCTGTGCCGAGGTGGGAAGCCAGTGCCCCTCTCTAAAGTCTTCAGCCTG
GAGCAGGACCCAGAGGAGGCTCAAAGGGTGAAGGACCAAAAAGCCATCATCACAGAGGAC
AACAAAGTGAATGGGGTAACCTGCTGTACCCGGATGCTGGGCTGTACATACCTCTACCCT
TGGATCCTCCCCAAGCCCCACATATCTTCCACTCCGCTGACCATTCAAGATGAGTTGCTG
ATTCTGGGAAACAAAGCATTGTGGGAACACTTGTCCTACACAGAAGCTGTCAATGCTGTA
CGTCACGTACAAGACCCATTAGCAGCTGCTAAGAAGCTGTGCACATTAGCGCAGAGCTAT
GGCTGTCAGGACAATGTAGGGGCGATGGTAGTTTATTTGAATATTGGTGAGGAAGGCTGC
ACTTGTGAAATGAATGGGCTCACCCTCCCAGGTCCTGTGGGATTTGCTTCAACCACCACT
ATCAAGGATGCCCCTAAGCCAGCCACTCCATCCTCTAGCAGTGGGATTGCCTCTGAGTTC
AGCAGTGAGATGTCCACCTCAGAGGTGAGCAGTGAAGTGGGGTCCACTGCTTCTGATGAG
CATAATGCTGGGGGCCTGGACACTGCCTTGCTTCCGAGGCCAGAGCGGCGCTGCAGCCTC
CACCCAACACCCACCTCTGGGCTGTTTCAGCGCCAGCCTTCTTCTGCTACCTTCTCCAGT
AACCAGTCTGACAACGGCCTGGACAGTGATGATGACCAGCCCGTTGAGGGGGTCATAACC
AATGGCAGCAAGGTAGAGGTGGAAGTAGACATCCACTGCTGCAGGGGGAGGGATCTGGAG
AACTCACCCCCTCTCATAGAGAGTTCTCCTACCCTGTGTTCTGAGGAACATGCTAGAGGG
TCGTGTTTTGGGATCCGAAGACAGAACAGTGTGAATAGTGGCATGCTCCTGCCAATGAGC
AAGGACAGGATGGAGTTACAGAAGTCTCCCTCCACCTCCTGCCTCTATGGGAAGAAACTC
TCCAATGGCTCTATTGTGCCCCTAGAGGACAGCCTGAACCTCATTGAAGTGGCCACAGAA
GTGCCCAAGAGGAAAACTGGCTATTTTGCTGCCCCCACTCAGATGGAACCAGAGGACCAG
TTTGTTGTGCCTCATGACCTGGAAGAAGAAGTGAAGGAACAAATGAAACAGCACCAGGAC
AGCCGGCTCGAGCCTGAGCCCCATGAAGAGGATCGGACCGAGCCCCCGGAGGAGTTCGAC
ACAGCACTATGA
Protein Properties
Number of Residues 1323
Molecular Weight 146749.61
Theoretical pI 5.707
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>PH domain leucine-rich repeat-containing protein phosphatase 2
MKRNGSRNCLNRRSRFGSRERDWLREDVKRGCVYLYGADTTTATTTTTTSSSSSSSSSSS
DLHLVLCTVETPASEICAGEGRESLYLQLHGDLVRRLEPTERPLQIVYDYLSRLGFDDPV
RIQEEATNPDLGCMIRFYGEKPCHMDRLDRILLSGIYNVRKGKTQLHKWAERLVVLCGTC
LIVSSVKDCQTGKMHILPLVGGKIEEVKRRQYSLAFSSAGAQAQTYHVSFETLAEYQRWQ
RQASKVVSQRISTVDLSCYSLEEVPEHLFYSQDITYLNLRHNFMQLERPGGLDTLYKFSQ
LKGLNLSHNKLGLFPILLCEISTLTELNLSCNGFHDLPSQIGNLLNLQTLCLDGNFLTTL
PEELGNLQQLSSLGISFNNFSQIPEVYEKLTMLDRVVMAGNCLEVLNLGVLNRMNHIKHV
DLRMNHLKTMVIENLEGNKHITHVDLRDNRLTDLDLSSLCSLEQLHCGRNQLRELTLSGF
SLRTLYASSNRLTAVNVYPVPSLLTFLDLSRNLLECVPDWACEAKKIEVLDVSYNLLTEV
PVRILSSLSLRKLMLGHNHVQNLPTLVEHIPLEVLDLQHNALTRLPDTLFSKALNLRYLN
ASANSLESLPSACTGEESLSMLQLLYLTNNLLTDQCIPVLVGHLHLRILHLANNQLQTFP
ASKLNKLEQLEELNLSGNKLKTIPTTIANCKRLHTLVAHSNNISIFPEILQLPQIQFVDL
SCNDLTEILIPEALPATLQDLDLTGNTNLVLEHKTLDIFSHITTLKIDQKPLPTTDSTVT
STFWSHGLAEMAGQRNKLCVSALAMDSFAEGVGAVYGMFDGDRNEELPRLLQCTMADVLL
EEVQQSTNDTVFMANTFLVSHRKLGMAGQKLGSSALLCYIRPDTADPASSFSLTVANVGT
CQAVLCRGGKPVPLSKVFSLEQDPEEAQRVKDQKAIITEDNKVNGVTCCTRMLGCTYLYP
WILPKPHISSTPLTIQDELLILGNKALWEHLSYTEAVNAVRHVQDPLAAAKKLCTLAQSY
GCQDNVGAMVVYLNIGEEGCTCEMNGLTLPGPVGFASTTTIKDAPKPATPSSSSGIASEF
SSEMSTSEVSSEVGSTASDEHNAGGLDTALLPRPERRCSLHPTPTSGLFQRQPSSATFSS
NQSDNGLDSDDDQPVEGVITNGSKVEVEVDIHCCRGRDLENSPPLIESSPTLCSEEHARG
SCFGIRRQNSVNSGMLLPMSKDRMELQKSPSTSCLYGKKLSNGSIVPLEDSLNLIEVATE
VPKRKTGYFAAPTQMEPEDQFVVPHDLEEEVKEQMKQHQDSRLEPEPHEEDRTEPPEEFD
TAL
GenBank ID Protein 65301141
UniProtKB/Swiss-Prot ID Q6ZVD8
UniProtKB/Swiss-Prot Entry Name PHLP2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_015020.2
GeneCard ID PHLPP2
GenAtlas ID PHLPP2
HGNC ID HGNC:29149
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M, Couronne O, Aerts A, Bajorek E, Black S, Blumer H, Branscomb E, Brown NC, Bruno WJ, Buckingham JM, Callen DF, Campbell CS, Campbell ML, Campbell EW, Caoile C, Challacombe JF, Chasteen LA, Chertkov O, Chi HC, Christensen M, Clark LM, Cohn JD, Denys M, Detter JC, Dickson M, Dimitrijevic-Bussod M, Escobar J, Fawcett JJ, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Goodwin LA, Grady DL, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Hildebrand CE, Huang W, Israni S, Jett J, Jewett PB, Kadner K, Kimball H, Kobayashi A, Krawczyk MC, Leyba T, Longmire JL, Lopez F, Lou Y, Lowry S, Ludeman T, Manohar CF, Mark GA, McMurray KL, Meincke LJ, Morgan J, Moyzis RK, Mundt MO, Munk AC, Nandkeshwar RD, Pitluck S, Pollard M, Predki P, Parson-Quintana B, Ramirez L, Rash S, Retterer J, Ricke DO, Robinson DL, Rodriguez A, Salamov A, Saunders EH, Scott D, Shough T, Stallings RL, Stalvey M, Sutherland RD, Tapia R, Tesmer JG, Thayer N, Thompson LS, Tice H, Torney DC, Tran-Gyamfi M, Tsai M, Ulanovsky LE, Ustaszewska A, Vo N, White PS, Williams AL, Wills PL, Wu JR, Wu K, Yang J, Dejong P, Bruce D, Doggett NA, Deaven L, Schmutz J, Grimwood J, Richardson P, Rokhsar DS, Eichler EE, Gilna P, Lucas SM, Myers RM, Rubin EM, Pennacchio LA: The sequence and analysis of duplication-rich human chromosome 16. Nature. 2004 Dec 23;432(7020):988-94. [PubMed:15616553 ]
  5. Nagase T, Ishikawa K, Suyama M, Kikuno R, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Feb 26;6(1):63-70. [PubMed:10231032 ]
  6. Gao T, Brognard J, Newton AC: The phosphatase PHLPP controls the cellular levels of protein kinase C. J Biol Chem. 2008 Mar 7;283(10):6300-11. Epub 2007 Dec 27. [PubMed:18162466 ]
  7. Brognard J, Sierecki E, Gao T, Newton AC: PHLPP and a second isoform, PHLPP2, differentially attenuate the amplitude of Akt signaling by regulating distinct Akt isoforms. Mol Cell. 2007 Mar 23;25(6):917-31. [PubMed:17386267 ]
  8. Liu J, Weiss HL, Rychahou P, Jackson LN, Evers BM, Gao T: Loss of PHLPP expression in colon cancer: role in proliferation and tumorigenesis. Oncogene. 2009 Feb 19;28(7):994-1004. doi: 10.1038/onc.2008.450. Epub 2008 Dec 15. [PubMed:19079341 ]