You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08916
Secondary Accession Numbers
  • 14645
Name Dual specificity protein phosphatase 9
Synonyms
  1. MAP kinase phosphatase 4
  2. MKP-4
  3. Mitogen-activated protein kinase phosphatase 4
Gene Name DUSP9
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatase activity
Specific Function Inactivates MAP kinases. Has a specificity for the ERK family.
Pathways
  • MAPK signaling pathway
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphoric acid details
A phosphoprotein + Water → a protein + Phosphoric acid details
GO Classification
Biological Process
JNK cascade
peptidyl-tyrosine dephosphorylation
Cellular Component
cytosol
endoplasmic reticulum
nucleus
Function
phosphoprotein phosphatase activity
protein tyrosine phosphatase activity
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
map kinase tyrosine/serine/threonine phosphatase activity
protein tyrosine/serine/threonine phosphatase activity
Molecular Function
MAP kinase tyrosine/serine/threonine phosphatase activity
protein tyrosine phosphatase activity
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
protein amino acid dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location X
Locus Xq28
SNPs DUSP9
Gene Sequence
>1155 bp
ATGGAGGGTCTGGGCCGCTCGTGCCTGTGGCTGCGTCGGGAGCTGTCGCCCCCGCGGCCG
CGGCTCCTGCTCCTGGACTGCCGCAGCCGCGAGCTGTACGAGTCGGCGCGCATCGGTGGG
GCGCTGAGCGTGGCCCTGCCGGCGCTCCTGCTGCGCCGCCTGCGGAGGGGCAGCCTGTCG
GTGCGCGCGCTCCTGCCTGGGCCGCCGCTGCAGCCGCCCCCGCCTGCCCCCGTGCTCCTG
TACGACCAGGGCGGGGGCCGGCGCCGGCGCGGGGAGGCCGAGGCCGAGGCCGAGGAGTGG
GAGGCCGAGTCGGTGCTGGGCACCCTGCTGCAGAAGCTGCGAGAGGAAGGCTACCTGGCC
TACTACCTCCAGGGAGGCTTCAGCAGATTCCAGGCCGAGTGCCCTCACCTGTGTGAGACC
AGCCTTGCTGGCCGTGCCGGCTCCAGCATGGCGCCGGTGCCCGGTCCAGTGCCCGTGGTG
GGGTTGGGCAGCCTGTGCCTGGGCTCCGACTGCTCTGATGCGGAATCCGAGGCTGACCGC
GACTCCATGAGCTGTGGCCTGGATTCGGAGGGTGCCACACCCCCACCAGTGGGGCTGCGG
GCATCCTTCCCTGTCCAGATCCTGCCCAACCTCTATCTGGGCAGTGCCCGGGATTCCGCC
AATTTGGAGAGCCTGGCCAAACTGGGCATCCGCTACATCCTCAATGTCACCCCCAACCTC
CCAAACTTCTTCGAGAAGAATGGTGACTTTCACTACAAGCAGATCCCCATCTCCGACCAC
TGGAGCCAGAACCTGTCGCGGTTCTTTCCGGAGGCCATTGAGTTCATTGATGAGGCCTTG
TCCCAGAACTGCGGGGTGCTCGTCCACTGCTTGGCGGGGGTCAGCCGTTCTGTCACCGTC
ACTGTGGCCTACCTCATGCAGAAGCTCCACCTCTCTCTCAACGATGCCTATGACCTGGTC
AAGAGGAAGAAGTCTAACATCTCCCCCAACTTCAACTTCATGGGGCAGTTGCTGGACTTT
GAGCGCAGCTTGCGGCTGGAGGAGCGCCACTCGCAGGAGCAGGGCAGTGGGGGGCAGGCA
TCTGCGGCCTCCAACCCGCCCTCCTTCTTCACCACCCCCACCAGTGATGGCGCCTTCGAG
CTGGCCCCCACCTAG
Protein Properties
Number of Residues 384
Molecular Weight 41867.055
Theoretical pI 6.117
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Dual specificity protein phosphatase 9
MEGLGRSCLWLRRELSPPRPRLLLLDCRSRELYESARIGGALSVALPALLLRRLRRGSLS
VRALLPGPPLQPPPPAPVLLYDQGGGRRRRGEAEAEAEEWEAESVLGTLLQKLREEGYLA
YYLQGGFSRFQAECPHLCETSLAGRAGSSMAPVPGPVPVVGLGSLCLGSDCSDAESEADR
DSMSCGLDSEGATPPPVGLRASFPVQILPNLYLGSARDSANLESLAKLGIRYILNVTPNL
PNFFEKNGDFHYKQIPISDHWSQNLSRFFPEAIEFIDEALSQNCGVLVHCLAGVSRSVTV
TVAYLMQKLHLSLNDAYDLVKRKKSNISPNFNFMGQLLDFERSLRLEERHSQEQGSGGQA
SAASNPPSFFTTPTSDGAFELAPT
GenBank ID Protein 4503421
UniProtKB/Swiss-Prot ID Q99956
UniProtKB/Swiss-Prot Entry Name DUS9_HUMAN
PDB IDs
GenBank Gene ID NM_001395.2
GeneCard ID DUSP9
GenAtlas ID DUSP9
HGNC ID HGNC:3076
References
General References
  1. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651 ]
  2. Muda M, Boschert U, Smith A, Antonsson B, Gillieron C, Chabert C, Camps M, Martinou I, Ashworth A, Arkinstall S: Molecular cloning and functional characterization of a novel mitogen-activated protein kinase phosphatase, MKP-4. J Biol Chem. 1997 Feb 21;272(8):5141-51. [PubMed:9030581 ]