You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08921
Secondary Accession Numbers
  • 14650
Name M-phase inducer phosphatase 3
Synonyms
  1. Dual specificity phosphatase Cdc25C
Gene Name CDC25C
Protein Type Enzyme
Biological Properties
General Function Involved in protein tyrosine phosphatase activity
Specific Function Functions as a dosage-dependent inducer in mitotic control. Tyrosine protein phosphatase required for progression of the cell cycle. When phosphorylated, highly effective in activating G2 cells into prophase. Directly dephosphorylates CDK1 and activates its kinase activity.
Pathways
  • Cell cycle
  • Oocyte meiosis
  • Progesterone-mediated oocyte maturation
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphoric acid details
GO Classification
Biological Process
cell division
M phase of mitotic cell cycle
traversing start control point of mitotic cell cycle
G2/M transition of mitotic cell cycle
cell proliferation
DNA replication
cell cycle checkpoint
regulation of cyclin-dependent protein kinase activity
virus-host interaction
regulation of mitosis
mitosis
Cellular Component
cytosol
nucleoplasm
Component
cell part
intracellular
Function
phosphoprotein phosphatase activity
protein tyrosine phosphatase activity
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
Molecular Function
protein tyrosine phosphatase activity
Process
phosphorus metabolic process
phosphate metabolic process
m phase
dephosphorylation
m phase of mitotic cell cycle
protein amino acid dephosphorylation
metabolic process
cellular process
cellular metabolic process
cell cycle process
cell cycle phase
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location 5
Locus 5q31
SNPs CDC25C
Gene Sequence
>1422 bp
ATGTCTACGGAACTCTTCTCATCCACAAGAGAGGAAGGAAGCTCTGGCTCAGGACCCAGT
TTTAGGTCTAATCAAAGGAAAATGTTAAACCTGCTCCTGGAGAGAGACACTTCCTTTACC
GTCTGTCCAGATGTCCCTAGAACTCCAGTGGGCAAATTTCTTGGTGATTCTGCAAACCTA
AGCATTTTGTCTGGAGGAACCCCAAAACGTTGCCTCGATCTTTCGAATCTTAGCAGTGGG
GAGATAACTGCCACTCAGCTTACCACTTCTGCAGACCTTGATGAAACTGGTCACCTGGAT
TCTTCAGGACTTCAGGAAGTGCATTTAGCTGGGATGAATCATGACCAGCACCTAATGAAA
TGTAGCCCAGCACAGCTTCTTTGTAGCACTCCGAATGGTTTGGACCGTGGCCATAGAAAG
AGAGATGCAATGTGTAGTTCATCTGCAAATAAAGAAAATGACAATGGAAACTTGGTGGAC
AGTGAAATGAAATATTTGGGCAGTCCCATTACTACTGTTCCAAAATTGGATAAAAATCCA
AACCTAGGAGAAGACCAGGCAGAAGAGATTTCAGATGAATTAATGGAGTTTTCCCTGAAA
GATCAAGAAGCAAAGGTGAGCAGAAGTGGCCTATATCGCTCCCCGTCGATGCCAGAGAAC
TTGAACAGGCCAAGACTGAAGCAGGTGGAAAAATTCAAGGACAACACAATACCAGATAAA
GTTAAAAAAAAGTATTTTTCTGGCCAAGGAAAGCTCAGGAAGGGCTTATGTTTAAAGAAG
ACAGTCTCTCTGTGTGACATTACTATCACTCAGATGCTGGAGGAAGATTCTAACCAGGGG
CACCTGATTGGTGATTTTTCCAAGGTATGTGCGCTGCCAACCGTGTCAGGGAAACACCAA
GATCTGAAGTATGTCAACCCAGAAACAGTGGCTGCCTTACTGTCGGGGAAGTTCCAGGGT
CTGATTGAGAAGTTTTATGTCATTGATTGTCGCTATCCATATGAGTATCTGGGAGGACAC
ATCCAGGGAGCCTTAAACTTATATAGTCAGGAAGAACTGTTTAACTTCTTTCTGAAGAAG
CCCATCGTCCCTTTGGACACCCAGAAGAGAATAATCATCGTGTTCCACTGTGAATTCTCC
TCAGAGAGGGGCCCCCGAATGTGCCGCTGTCTGCGTGAAGAGGACAGGTCTCTGAACCAG
TATCCTGCATTGTACTACCCAGAGCTATATATCCTTAAAGGCGGCTACAGAGACTTCTTT
CCAGAATATATGGAACTGTGTGAACCACAGAGCTACTGCCCTATGCATCATCAGGACCAC
AAGACTGAGTTGCTGAGGTGTCGAAGCCAGAGCAAAGTGCAGGAAGGGGAGCGGCAGCTG
CGGGAGCAGATTGCCCTTCTGGTGAAGGACATGAGCCCATGA
Protein Properties
Number of Residues 473
Molecular Weight 53364.17
Theoretical pI 6.784
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>M-phase inducer phosphatase 3
MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANL
SILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMK
CSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNP
NLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDK
VKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQ
DLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKK
PIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFF
PEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
GenBank ID Protein 125625350
UniProtKB/Swiss-Prot ID P30307
UniProtKB/Swiss-Prot Entry Name MPIP3_HUMAN
PDB IDs
GenBank Gene ID NM_001790.3
GeneCard ID CDC25C
GenAtlas ID CDC25C
HGNC ID HGNC:1727
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  5. Lu R, Niida H, Nakanishi M: Human SAD1 kinase is involved in UV-induced DNA damage checkpoint function. J Biol Chem. 2004 Jul 23;279(30):31164-70. Epub 2004 May 18. [PubMed:15150265 ]
  6. Bonni S, Ganuelas ML, Petrinac S, Hudson JW: Human Plk4 phosphorylates Cdc25C. Cell Cycle. 2008 Feb 15;7(4):545-7. Epub 2007 Nov 25. [PubMed:18239451 ]
  7. Wegener S, Hampe W, Herrmann D, Schaller HC: Alternative splicing in the regulatory region of the human phosphatases CDC25A and CDC25C. Eur J Cell Biol. 2000 Nov;79(11):810-5. [PubMed:11139144 ]
  8. Sadhu K, Reed SI, Richardson H, Russell P: Human homolog of fission yeast cdc25 mitotic inducer is predominantly expressed in G2. Proc Natl Acad Sci U S A. 1990 Jul;87(13):5139-43. [PubMed:2195549 ]
  9. Bureik M, Rief N, Drescher R, Jungbluth A, Montenarh M, Wagner P: An additional transcript of the cdc25C gene from A431 cells encodes a functional protein. Int J Oncol. 2000 Dec;17(6):1251-8. [PubMed:11078813 ]
  10. Hernandez S, Bessa X, Bea S, Hernandez L, Nadal A, Mallofre C, Muntane J, Castells A, Fernandez PL, Cardesa A, Campo E: Differential expression of cdc25 cell-cycle-activating phosphatases in human colorectal carcinoma. Lab Invest. 2001 Apr;81(4):465-73. [PubMed:11304565 ]
  11. Goh WC, Manel N, Emerman M: The human immunodeficiency virus Vpr protein binds Cdc25C: implications for G2 arrest. Virology. 2004 Jan 5;318(1):337-49. [PubMed:14972559 ]