You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08968
Secondary Accession Numbers
  • 14702
Name Kynurenine--oxoglutarate transaminase 3
Synonyms
  1. Cysteine-S-conjugate beta-lyase 2
  2. KATIII
  3. Kynurenine aminotransferase III
  4. Kynurenine--glyoxylate transaminase
  5. Kynurenine--oxoglutarate transaminase III
Gene Name CCBL2
Protein Type Enzyme
Biological Properties
General Function Involved in transferase activity, transferring nitrogenous groups
Specific Function Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). May catalyze the beta-elimination of S-conjugates and Se-conjugates of L-(seleno)cysteine, resulting in the cleavage of the C-S or C-Se bond (By similarity). Has transaminase activity towards L-kynurenine, tryptophan, phenylalanine, serine, cysteine, methionine, histidine, glutamine and asparagine with glyoxylate as an amino group acceptor (in vitro). Has lower activity with 2-oxoglutarate as amino group acceptor (in vitro) (By similarity).
Pathways
  • Chemical carcinogenesis
  • Selenocompound metabolism
  • Tryptophan metabolism
Reactions
L-Kynurenine + Oxoglutaric acid → 4-(2-Aminophenyl)-2,4-dioxobutanoic acid + L-Glutamic acid details
RS-CH(2)-CH(NH(3)(+))COO(-) + Water → RSH + Ammonia + Pyruvic acid details
L-Kynurenine + Glyoxylic acid → 4-(2-Aminophenyl)-2,4-dioxobutanoic acid + Glycine details
L-3-Hydroxykynurenine + Oxoglutaric acid → 4-(2-Amino-3-hydroxyphenyl)-2,4-dioxobutanoic acid + L-Glutamic acid details
Se-Methylselenocysteine + 2-Oxo-4-methylthiobutanoic acid → Methylselenopyruvate + L-Methionine details
GO Classification
Biological Process
tryptophan catabolic process
2-oxoglutarate metabolic process
biosynthetic process
Cellular Component
mitochondrion
Function
binding
catalytic activity
transferase activity
transferase activity, transferring nitrogenous groups
cofactor binding
pyridoxal phosphate binding
Molecular Function
kynurenine-oxoglutarate transaminase activity
pyridoxal phosphate binding
cysteine-S-conjugate beta-lyase activity
kynurenine-glyoxylate transaminase activity
Process
metabolic process
biosynthetic process
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1p22.2
SNPs CCBL2
Gene Sequence
>1365 bp
ATGTTTTTGGCCCAGAGGAGCCTCTGCTCTCTTAGCGGTAGAGCAAAATTCCTGAAGACA
ATTTCTTCTTCCAAAATCCTCGGATTCTCTACTTCTGCTAAAATGTCACTGAAATTCACA
AATGCAAAACGGATTGAAGGACTTGATAGTAATGTGTGGATTGAATTTACCAAATTGGCT
GCAGACCCTTCTGTTGTGAATCTTGGCCAAGGCTTTCCAGATATATCCCCTCCTACATAT
GTAAAAGAAGAATTATCAAAGATTGCAGCAATCGATAGCCTGAATCAGTATACACGAGGC
TTTGGCCATCCATCACTTGTGAAAGCTCTGTCCTATCTGTATGAAAAGCTTTATCAAAAG
CAAATTGATTCAAATAAAGAAATCCTTGTGACAGTAGGAGCATATGGATCTCTTTTTAAC
ACCATTCAAGCATTAATTGATGAGGGAGATGAAGTCATACTAATAGTGCCTTTCTATGAC
TGCTATGAGCCCATGGTGAGAATGGCTGGAGCAACACCTGTTTTTATTCCCCTGAGATCT
AAACCTGTTTATGGAAAAAGATGGTCTAGTTCTGACTGGACATTAGATCCTCAAGAACTG
GAAAGTAAATTTAATTCCAAAACCAAAGCTATTATACTAAATACTCCACATAACCCACTT
GGCAAGGTGTATAACAGAGAGGAACTGCAAGTAATTGCTGACCTTTGCATCAAATATGAC
ACACTCTGCATCAGCGATGAGGTTTATGAATGGCTTGTATATTCTGGAAATAAGCACTTA
AAAATAGCTACTTTTCCAGGTATGTGGGAGAGAACAATAACAATAGGAAGTGCTGGAAAG
ACTTTCAGTGTAACTGGCTGGAAGCTTGGCTGGTCCATTGGTCCAAATCATTTGATAAAA
CATTTACAGACAGTTCAACAAAACACGATTTATACTTGTGCAACTCCTTTACAGGAAGCC
TTGGCTCAAGCTTTCTGGATTGACATCAAGCGCATGGATGACCCAGAATGTTACTTTAAT
TCTTTGCCAAAAGAGTTAGAAGTAAAAAGAGATCGGATGGTACGTTTACTTGAAAGTGTT
GGCCTAAAACCCATAGTTCCTGATGGAGGATACTTCATCATCGCTGATGTGTCTTTGCTA
GATCCAGACCTCTCTGATATGAAGAATAATGAGCCTTATGACTATAAGTTTGTGAAATGG
ATGACTAAACATAAGAAACTATCAGCCATCCCCGTTTCAGCATTCTGTAACTCAGAGACT
AAATCACAGTTTGAGAAGTTTGTGCGTTTTTGCTTCATTAAAAAAGACAGCACACTGGAT
GCTGCTGAAGAAATCATCAAGGCATGGAGTGTACAGAAGTCTTGA
Protein Properties
Number of Residues 454
Molecular Weight 51399.855
Theoretical pI 8.188
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Kynurenine--oxoglutarate transaminase 3
MFLAQRSLCSLSGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLA
ADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHPSLVKALSYLYEKLYQK
QIDSNKEILVTVGAYGSLFNTIQALIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPLRS
KPVYGKRWSSSDWTLDPQELESKFNSKTKAIILNTPHNPLGKVYNREELQVIADLCIKYD
TLCISDEVYEWLVYSGNKHLKIATFPGMWERTITIGSAGKTFSVTGWKLGWSIGPNHLIK
HLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESV
GLKPIVPDGGYFIIADVSLLDPDLSDMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSET
KSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q6YP21
UniProtKB/Swiss-Prot Entry Name KAT3_HUMAN
PDB IDs Not Available
GenBank Gene ID AY028624
GeneCard ID CCBL2
GenAtlas ID CCBL2
HGNC ID HGNC:33238
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  5. Yu P, Li Z, Zhang L, Tagle DA, Cai T: Characterization of kynurenine aminotransferase III, a novel member of a phylogenetically conserved KAT family. Gene. 2006 Jan 3;365:111-8. Epub 2006 Jan 10. [PubMed:16376499 ]