You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09204
Secondary Accession Numbers
  • 14986
Name Transcription initiation factor TFIID subunit 4
Synonyms
  1. RNA polymerase II TBP-associated factor subunit C
  2. TAF(II)130
  3. TAF(II)135
  4. TAFII-130
  5. TAFII-135
  6. TAFII130
  7. TAFII135
  8. TBP-associated factor 4
  9. Transcription initiation factor TFIID 130 kDa subunit
  10. Transcription initiation factor TFIID 135 kDa subunit
Gene Name TAF4
Protein Type Enzyme
Biological Properties
General Function Involved in DNA binding
Specific Function Makes part of TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. Potentiates transcriptional activation by the AF-2S of the retinoic acid, vitamin D3 and thyroid hormone
Pathways Not Available
Reactions Not Available
GO Classification
Component
transcription factor complex
macromolecular complex
protein complex
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
transcription factor tfiid complex
Function
binding
transcription regulator activity
nucleic acid binding
dna binding
sequence-specific dna binding transcription factor activity
transcription initiation factor activity
Process
cellular component organization or biogenesis
biological regulation
cellular component organization
regulation of biological process
cellular component assembly
regulation of metabolic process
macromolecular complex assembly
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
regulation of transcription, dna-dependent
protein complex assembly
transcription initiation
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:2
Locus 20q13.33
SNPs TAF4
Gene Sequence
>3258 bp
ATGGCGGCGGGCTCGGATCTGCTGGACGAGGTCTTCTTCAACAGCGAGGTGGACGAGAAA
GTGGTGAGCGACCTGGTGGGCTCGCTGGAGTCGCAGCTGGCGGCCAGCGCGGCCCACCAC
CACCACCTCGCGCCGCGCACGCCCGAGGTGCGGGCCGCGGCCGCCGGCGCGCTCGGGAAC
CATGTTGTGAGCGGCAGCCCGGCCGGAGCCGCGGGCGCAGGGCCGGCCGCCCCCGCCGAG
GGCGCGCCCGGAGCGGCGCCGGAGCCGCCCCCCGCAGGTAGAGCGCGGCCGGGGGGCGGG
GGGCCGCAGCGCCCGGGCCCCCCCTCACCGCGCCGCCCCCTTGTCCCCGCAGGGCCCGCG
CCGCCCGCCGCGAAGCTGAGGCCGCCGCCCGAGGGCAGCGCGGGGTCCTGCGCCCCGGTG
CCCGCCGCCGCCGCCGTCGCCGCGGGGCCCGAGCCCGCCCCCGCCGGCCCCGCCAAGCCC
GCCGGCCCCGCCGCGCTGGCCGCCCGCGCCGGCCCCGGCCCCGGGCCCGGCCCCGGCCCC
GGCCCCGGCCCTGGCCCTGGCAAGCCCGCCGGCCCCGGCGCCGCGCAAACTTTGAATGGG
AGCGCCGCGCTGCTGAACTCGCACCACGCCGCCGCACCTGCTGTCAGCCTGGTCAACAAC
GGGCCCGCCGCGCTGCTGCCGCTGCCCAAGCCCGCCGCCCCCGGCACTGTCATCCAGACG
CCCCCCTTCGTGGGCGCCGCCGCGCCCCCCGCGCCCGCCGCGCCCTCGCCCCCCGCCGCC
CCCGCGCCCGCCGCCCCCGCCGCCGCCCCGCCCCCGCCACCCCCCGCGCCCGCCACTCTG
GCCCGGCCGCCCGGCCACCCCGCCGGACCCCCGACCGCCGCGCCCGCCGTGCCGCCCCCC
GCCGCCGCCCAGAACGGGGGCAGCGCCGGGGCAGCCCCCGCCCCCGCCCCGGCCGCCGGG
GGCCCCGCGGGGGTCAGCGGCCAACCCGGGCCCGGCGCGGCGGCTGCGGCGCCGGCGCCG
GGGGTCAAGGCCGAGTCGCCCAAGAGGGTGGTGCAGGCGGCGCCCCCGGCGGCGCAGACC
CTGGCGGCCAGCGGCCCGGCCAGCACGGCGGCCAGCATGGTCATCGGGCCAACTATGCAA
GGGGCGCTGCCCAGCCCGGCCGCCGTCCCGCCGCCCGCCCCCGGGACCCCCACCGGGCTG
CCCAAAGGCGCGGCCGGCGCAGTGACCCAGAGCCTGTCCCGGACGCCCACGGCCACCACC
AGCGGGATTCGGGCCACCCTGACGCCCACCGTGCTGGCCCCCCGCTTGCCGCAGCCGCCT
CAGAACCCGACCAACATCCAGAACTTCCAGCTGCCCCCAGGAATGGTCCTCGTCCGAAGT
GAGAATGGGCAGTTGTTAATGATTCCTCAGCAGGCCTTGGCCCAGATGCAGGCGCAGGCC
CATGCCCAGCCTCAGACCACCATGGCGCCTCGCCCTGCCACCCCCACAAGTGCCCCTCCC
GTCCAGATCTCCACCGTACAGGCACCTGGAACACCTATCATTGCACGGCAGGTGACCCCA
ACTACCATAATTAAGCAAGTGTCTCAGGCCCAGACAACGGTGCAGCCCAGTGCAACCCTG
CAGCGCTCGCCCGGCGTCCAGCCTCAGCTCGTTCTGGGTGGCGCTGCCCAGACGGCTTCA
CTTGGGACGGCGACGGCTGTTCAGACGGGGACTCCTCAGCGCACGGTACCAGGGGCGACC
ACCACTTCCTCAGCTGCCACGGAAACTATGGAAAACGTGAAGAAATGTAAAAATTTCCTA
TCTACGTTAATAAAACTGGCTTCATCTGGCAAGCAGTCTACAGAGACAGCAGCTAATGTG
AAAGAGCTCGTGCAGAATTTACTGGATGGAAAAATAGAAGCAGAAGATTTCACAAGCAGG
TTATACCGAGAACTTAATTCTTCACCTCAACCTTACCTTGTGCCTTTCCTGAAGAGGAGC
TTACCCGCCTTGAGACAGCTGACCCCCGACTCCGCGGCCTTCATCCAGCAGAGCCAGCAG
CAGCCGCCACCGCCCACCTCGCAGGCCACCACTGCGCTCACGGCCGTGGTGCTGAGTAGC
TCGGTCCAGCGCACGGCCGGGAAGACGGCGGCCACCGTGACCAGTGCCCTCCAGCCCCCT
GTGCTCAGCCTCACGCAGCCCACGCAGGTCGGCGTCGGCAAGCAGGGGCAACCCACACCG
CTGGTCATCCAGCAGCCTCCGAAGCCAGGAGCCCTGATCCGGCCCCCGCAGGTGACGTTG
ACGCAGACACCCATGGTCGCCCTGCGGCAGCCTCACAACCGGATCATGCTCACCACGCCT
CAGCAGATCCAGCTGAACCCACTGCAGCCAGTCCCTGTGGTGAAACCCGCCGTGTTACCT
GGAACCAAAGCCCTTTCTGCTGTCTCGGCACAAGCAGCTGCTGCACAGAAAAATAAACTC
AAGGAGCCTGGGGGAGGTTCGTTTCGGGACGATGATGACATTAATGATGTTGCATCGATG
GCTGGAGTAAACTTGTCAGAAGAAAGTGCAAGAATATTAGCCACGAACTCTGAATTGGTG
GGCACGCTAACGCGGTCCTGTAAAGATGAAACCTTCCTCCTCCAAGCGCCTTTGCAGAGA
AGAATATTAGAAATAGGTAAAAAACATGGTATAACGGAATTACATCCAGATGTAGTAAGT
TATGTATCACATGCCACGCAACAAAGGCTACAGAATCTTGTAGAGAAAATATCAGAAACA
GCTCAGCAGAAGAACTTTTCTTACAAGGATGACGACAGATATGAGCAGGCGAGTGACGTC
CGGGCACAGCTCAAGTTTTTTGAACAGCTTGATCAAATCGAAAAGCAGAGGAAGGATGAG
CAGGAGCGGGAGATCCTGATGAGGGCAGCAAAGTCTCGGTCAAGACAAGAAGATCCAGAA
CAGTTAAGGCTGAAACAGAAGGCAAAGGAGATGCAGCAACAGGAACTGGCACAAATGAGA
CAGCGGGACGCCAACCTCACAGCACTAGCAGCGATCGGGCCCAGGAAAAAGAGGAAAGTG
GACTGTCCGGGGCCGGGCTCAGGAGCAGAGGGGTCGGGCCCCGGCTCAGTGGTCCCAGGC
AGCTCGGGTGTCGGAACCCCCAGACAGTTCACGCGACAAAGAATCACGCGGGTCAACCTC
AGGGACCTCATATTTTGTTTAGAAAATGAACGTGAGACAAGCCATTCACTGCTGCTCTAC
AAAGCATTCCTTAAGTGA
Protein Properties
Number of Residues 1085
Molecular Weight 110113.3
Theoretical pI 10.64
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Transcription initiation factor TFIID subunit 4
MAAGSDLLDEVFFNSEVDEKVVSDLVGSLESQLAASAAHHHHLAPRTPEVRAAAAGALGN
HVVSGSPAGAAGAGPAAPAEGAPGAAPEPPPAGRARPGGGGPQRPGPPSPRRPLVPAGPA
PPAAKLRPPPEGSAGSCAPVPAAAAVAAGPEPAPAGPAKPAGPAALAARAGPGPGPGPGP
GPGPGPGKPAGPGAAQTLNGSAALLNSHHAAAPAVSLVNNGPAALLPLPKPAAPGTVIQT
PPFVGAAAPPAPAAPSPPAAPAPAAPAAAPPPPPPAPATLARPPGHPAGPPTAAPAVPPP
AAAQNGGSAGAAPAPAPAAGGPAGVSGQPGPGAAAAAPAPGVKAESPKRVVQAAPPAAQT
LAASGPASTAASMVIGPTMQGALPSPAAVPPPAPGTPTGLPKGAAGAVTQSLSRTPTATT
SGIRATLTPTVLAPRLPQPPQNPTNIQNFQLPPGMVLVRSENGQLLMIPQQALAQMQAQA
HAQPQTTMAPRPATPTSAPPVQISTVQAPGTPIIARQVTPTTIIKQVSQAQTTVQPSATL
QRSPGVQPQLVLGGAAQTASLGTATAVQTGTPQRTVPGATTTSSAATETMENVKKCKNFL
STLIKLASSGKQSTETAANVKELVQNLLDGKIEAEDFTSRLYRELNSSPQPYLVPFLKRS
LPALRQLTPDSAAFIQQSQQQPPPPTSQATTALTAVVLSSSVQRTAGKTAATVTSALQPP
VLSLTQPTQVGVGKQGQPTPLVIQQPPKPGALIRPPQVTLTQTPMVALRQPHNRIMLTTP
QQIQLNPLQPVPVVKPAVLPGTKALSAVSAQAAAAQKNKLKEPGGGSFRDDDDINDVASM
AGVNLSEESARILATNSELVGTLTRSCKDETFLLQAPLQRRILEIGKKHGITELHPDVVS
YVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDE
QEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKV
DCPGPGSGAEGSGPGSVVPGSSGVGTPRQFTRQRITRVNLRDLIFCLENERETSHSLLLY
KAFLK
GenBank ID Protein 56204142
UniProtKB/Swiss-Prot ID O00268
UniProtKB/Swiss-Prot Entry Name TAF4_HUMAN
PDB IDs
GenBank Gene ID AL109911
GeneCard ID TAF4
GenAtlas ID TAF4
HGNC ID HGNC:11537
References
General References
  1. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. [PubMed:11780052 ]
  2. Dou Y, Milne TA, Tackett AJ, Smith ER, Fukuda A, Wysocka J, Allis CD, Chait BT, Hess JL, Roeder RG: Physical association and coordinate function of the H3 K4 methyltransferase MLL1 and the H4 K16 acetyltransferase MOF. Cell. 2005 Jun 17;121(6):873-85. [PubMed:15960975 ]
  3. Brand M, Yamamoto K, Staub A, Tora L: Identification of TATA-binding protein-free TAFII-containing complex subunits suggests a role in nucleosome acetylation and signal transduction. J Biol Chem. 1999 Jun 25;274(26):18285-9. [PubMed:10373431 ]
  4. Hamard PJ, Dalbies-Tran R, Hauss C, Davidson I, Kedinger C, Chatton B: A functional interaction between ATF7 and TAF12 that is modulated by TAF4. Oncogene. 2005 May 12;24(21):3472-83. [PubMed:15735663 ]
  5. Damania B, Alwine JC: TAF-like function of SV40 large T antigen. Genes Dev. 1996 Jun 1;10(11):1369-81. [PubMed:8647434 ]
  6. Mengus G, May M, Carre L, Chambon P, Davidson I: Human TAF(II)135 potentiates transcriptional activation by the AF-2s of the retinoic acid, vitamin D3, and thyroid hormone receptors in mammalian cells. Genes Dev. 1997 Jun 1;11(11):1381-95. [PubMed:9192867 ]
  7. Tanese N, Saluja D, Vassallo MF, Chen JL, Admon A: Molecular cloning and analysis of two subunits of the human TFIID complex: hTAFII130 and hTAFII100. Proc Natl Acad Sci U S A. 1996 Nov 26;93(24):13611-6. [PubMed:8942982 ]
  8. Cavusoglu N, Brand M, Tora L, Van Dorsselaer A: Novel subunits of the TATA binding protein free TAFII-containing transcription complex identified by matrix-assisted laser desorption/ionization-time of flight mass spectrometry following one-dimensional gel electrophoresis. Proteomics. 2003 Feb;3(2):217-23. [PubMed:12601814 ]
  9. Gangloff YG, Werten S, Romier C, Carre L, Poch O, Moras D, Davidson I: The human TFIID components TAF(II)135 and TAF(II)20 and the yeast SAGA components ADA1 and TAF(II)68 heterodimerize to form histone-like pairs. Mol Cell Biol. 2000 Jan;20(1):340-51. [PubMed:10594036 ]