You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09249
Secondary Accession Numbers
  • 15075
Name Threonine--tRNA ligase, mitochondrial
Synonyms
  1. ThrRS
  2. Threonine--tRNA ligase
  3. Threonyl-tRNA synthetase-like 1
  4. Threonyl-tRNA synthetase
Gene Name TARS2
Protein Type Enzyme
Biological Properties
General Function Involved in nucleotide binding
Specific Function Not Available
Pathways
  • Aminoacyl-tRNA biosynthesis
Reactions
Adenosine triphosphate + L-Threonine + tRNA(Thr) → Adenosine monophosphate + Pyrophosphate + L-threonyl-tRNA(Thr) details
Adenosine triphosphate + L-Threonine + tRNA(Thr) → Adenosine monophosphate + Pyrophosphate + L-Threonyl-tRNA(Thr) details
GO Classification
Biological Process
mitochondrial threonyl-tRNA aminoacylation
Cellular Component
mitochondrial matrix
Component
cell part
intracellular part
cytoplasm
Function
binding
nucleotide binding
catalytic activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
ligase activity
threonine-trna ligase activity
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-trna and related compounds
aminoacyl-trna ligase activity
Molecular Function
ATP binding
threonine-tRNA ligase activity
Process
rna metabolic process
ncrna metabolic process
trna metabolic process
trna aminoacylation
trna aminoacylation for protein translation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
threonyl-trna aminoacylation
biosynthetic process
Cellular Location
  1. Mitochondrion matrix
Gene Properties
Chromosome Location 1
Locus 1q21.3
SNPs TARS2
Gene Sequence
>2157 bp
ATGGCCCTGTATCAGAGGTGGCGGTGTCTCCGGCTCCAAGGTTTACAGGCTTGCAGGCTA
CACACGGCAGTTGTGTCGACCCCTCCACGCTGGTTGGCAGAGCGGCTTGGCCTTTTTGAG
GAGCTGTGGGCTGCTCAGGTAAAGAGATTAGCAAGCATGGCACAGAAGGAACCCCGGACT
ATTAAGATATCACTTCCTGGAGGCCAGAAAATTGATGCTGTGGCATGGAACACAACCCCC
TACCAACTAGCCCGGCAGATCAGTTCAACACTGGCAGATACTGCAGTGGCTGCTCAAGTG
AATGGAGAACCTTATGATCTGGAGCGGCCCTTGGAGACAGATTCTGACCTCAGATTTCTG
ACATTCGATTCCCCAGAGGGGAAAGCAGTGTTCTGGCACTCCAGCACCCATGTCCTGGGG
GCAGCAGCTGAACAATTCCTAGGTGCTGTTCTCTGCAGAGGTCCAAGTACAGAATATGGC
TTTTACCATGATTTCTTCCTGGGAAAGGAGAGGACAATCCGGGGCTCAGAGCTGCCTGTT
TTGGAGCGGATTTGCCAGGAACTTACAGCTGCTGCTCGACCCTTCCGGAGGCTAGAGGCT
TCACGGGATCAGCTTCGCCAGTTGTTCAAGGATAACCCCTTTAAGCTTCACTTGATTGAG
GAGAAAGTGACAGGTCCAACAGCAACAGTATATGGGTGTGGCACATTGGTTGACCTTTGC
CAGGGCCCCCACCTTCGGCATACTGGACAGATTGGAGGACTGAAGCTGCTATCGAACTCA
TCATCCTTATGGAGGTCTTCAGGGCCCCCAGAGACACTGCAGAGAGTGTCAGGGATTTCC
TTCCCCACAACAGAATTGCTGAGGGTCTGGGAAGCATGGAGGGAGGAAGCAGAATTGCGG
GACCACCGGCGCATTGGGAAGGAACAGGAGCTCTTCTTCTTCCATGAACTGAGCCCTGGG
AGCTGCTTCTTCCTGCCACGAGGGACAAGGGTGTATAATGCACTAGTGGCGTTTATCAGG
GCTGAGTATGCCCATCGTGGTTTCTCCGAGGTGAAAACTCCCACACTGTTTTCTACGAAG
CTCTGGGAACAGTCAGGGCACTGGGAGCATTATCAGGAAGACATGTTTGCCGTGCAGCCC
CCAGGCTCTGACAGGCCTCCCAGCTCCCAGAGTGACGATTCTACCAGGCATATCACAGAT
ACACTCGCCCTCAAGCCTATGAACTGCCCTGCACACTGCCTGATGTTCGCCCACCGGCCC
AGATCCTGGCGGGAACTGCCCCTGCGACTAGCTGACTTTGGGGCTCTACACCGGGCCGAA
GCCTCTGGTGGTCTGGGGGGACTGACCCGACTGCGGTGCTTCCAGCAGGATGACGCTCAC
ATCTTCTGTACAACAGATCAGCTGGAAGCAGAGATCCAAAGCTGTCTTGATTTCCTCCGT
TCCGTCTATGCCGTTCTTGGCTTCTCCTTCCGCCTGGCACTGTCCACCCGGCCATCTGGC
TTCCTGGGGGACCCTTGCCTTTGGGACCAGGCCGAACAGGTCCTTAAACAGGCCCTGAAG
GAATTTGGAGAACCCTGGGACCTCAACTCTGGAGATGGTGCCTTCTATGGACCTAAGATT
GACGTGCACCTCCACGATGCCCTGGGCCGGCCACATCAGTGTGGGACAATTCAGCTTGAC
TTCCAACTGCCCCTGAGATTTGACCTCCAGTATAAGGGGCAGGCGGGTGCCCTGGGGCGT
CCAGTCCTCATTCACCGAGCAGTGCTCGGTTCTGTGGAAAGACTGTTGGGAGTGCTGGCA
GAAAGCTGCGGGGGGAAATGGCCACTGTGGCTGTCCCCGTTCCAGGTGGTGGTCATCCCT
GTGGGGAGTGAGCAAGAGGAATACGCCAAAGAGGCACAGCAGAGCCTGCGGGCTGCAGGA
CTGGTCAGTGACCTGGATGCAGACTCTGGACTGACCCTCAGCCGGAGAATCCGCCGGGCC
CAGCTTGCCCACTACAATTTTCAGTTTGTGGTTGGCCAGAAAGAGCAAAGTAAGAGAACA
GTGAACATTCGGACTCGAGATAATCGTCGCCTTGGGGAGTGGGACTTGCCTGAGGCTGTG
CAGCGACTGGTGGAGCTACAGAACACGAGGGTCCCAAATGCCGAAGAAATTTTCTGA
Protein Properties
Number of Residues 718
Molecular Weight 81035.345
Theoretical pI 7.299
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Threonyl-tRNA synthetase, mitochondrial
MALYQRWRCLRLQGLQACRLHTAVVSTPPRWLAERLGLFEELWAAQVKRLASMAQKEPRT
IKISLPGGQKIDAVAWNTTPYQLARQISSTLADTAVAAQVNGEPYDLERPLETDSDLRFL
TFDSPEGKAVFWHSSTHVLGAAAEQFLGAVLCRGPSTEYGFYHDFFLGKERTIRGSELPV
LERICQELTAAARPFRRLEASRDQLRQLFKDNPFKLHLIEEKVTGPTATVYGCGTLVDLC
QGPHLRHTGQIGGLKLLSNSSSLWRSSGAPETLQRVSGISFPTTELLRVWEAWREEAELR
DHRRIGKEQELFFFHELSPGSCFFLPRGTRVYNALVAFIRAEYAHRGFSEVKTPTLFSTK
LWEQSGHWEHYQEDMFAVQPPGSDRPPSSQSDDSTRHITDTLALKPMNCPAHCLMFAHRP
RSWRELPLRLADFGALHRAEASGGLGGLTRLRCFQQDDAHIFCTTDQLEAEIQSCLDFLR
SVYAVLGFSFRLALSTRPSGFLGDPCLWDQAEQVLKQALKEFGEPWDLNSGDGAFYGPKI
DVHLHDALGRPHQCGTIQLDFQLPLRFDLQYKGQAGALERPVLIHRAVLGSVERLLGVLA
ESCGGKWPLWLSPFQVVVIPVGSEQEEYAKEAQQSLRAAGLVSDLDADSGLTLSRRIRRA
QLAHYNFQFVVGQKEQSKRTVNIRTRDNRRLGEWDLPEAVQRLVELQNTRVPNAEEIF
GenBank ID Protein 62897187
UniProtKB/Swiss-Prot ID Q9BW92
UniProtKB/Swiss-Prot Entry Name SYTM_HUMAN
PDB IDs Not Available
GenBank Gene ID AK222814
GeneCard ID TARS2
GenAtlas ID TARS2
HGNC ID HGNC:30740
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Bonnefond L, Fender A, Rudinger-Thirion J, Giege R, Florentz C, Sissler M: Toward the full set of human mitochondrial aminoacyl-tRNA synthetases: characterization of AspRS and TyrRS. Biochemistry. 2005 Mar 29;44(12):4805-16. [PubMed:15779907 ]