You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09260
Secondary Accession Numbers
  • 15088
Name Ubiquitin conjugation factor E4 B
Synonyms
  1. Homozygously deleted in neuroblastoma 1
  2. Ubiquitin fusion degradation protein 2
Gene Name UBE4B
Protein Type Enzyme
Biological Properties
General Function Involved in protein binding
Specific Function Binds to the ubiquitin moieties of preformed conjugates and catalyzes ubiquitin chain assembly in conjunction with E1, E2, and E3
Pathways Not Available
Reactions Not Available
GO Classification
Component
macromolecular complex
protein complex
ubiquitin ligase complex
Function
binding
catalytic activity
small conjugating protein ligase activity
ligase activity
protein binding
ligase activity, forming carbon-nitrogen bonds
acid-amino acid ligase activity
ubiquitin-protein ligase activity
ubiquitin-ubiquitin ligase activity
Process
metabolic process
macromolecule metabolic process
protein modification by small protein conjugation or removal
protein modification by small protein conjugation
protein ubiquitination
catabolic process
macromolecule catabolic process
cellular macromolecule catabolic process
modification-dependent macromolecule catabolic process
modification-dependent protein catabolic process
ubiquitin-dependent protein catabolic process
macromolecule modification
protein modification process
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 1p36.3
SNPs UBE4B
Gene Sequence
>3909 bp
ATGGAGGAGCTGAGCGCTGATGAGATTCGACGGAGGCGCCTTGCACGACTTGCTGGTGGA
CAGACCTCTCAGCCAACCACCCCACTCACCTCTCCCCAGAGGGAGAACCCTCCGGGGCCT
CCCATAGCGGCATCAGCCCCAGGACCCTCTCAGAGTCTTGGTCTCAATGTCCACAACATG
ACCCCAGCTACCTCCCCAATAGGTGCATCAGGAGTAGCCCATCGAAGCCAGAGCAGTGAA
GGAGTCAGTTCTCTCAGCAGCTCGCCCTCTAATAGCCTTGAAACGCAATCTCAGTCTCTC
TCACGTTCCCAGAGCATGGATATCGATGGTGTCTCATGTGAGAAAAGCATGTCCCAGGTG
GATGTGGATTCAGGAATTGAAAACATGGAGGTTGATGAAAATGATCGAAGAGAAAAGCGG
AGCCTCAGTGATAAGGAGCCTTCCTCGGGCCCTGAAGTGTCTGAAGAGCAGGCCTTACAG
CTGGTCTGTAAGATCTTCCGTGTCTCTTGGAAGGACCGGGACAGAGATGTCATCTTTCTT
TCTTCTCTTTCTGCACAGTTTAAGCAGAACCCAAAAGAAGTATTCTCCGATTTTAAGGAC
TTGATTGGCCAGATTTTAATGGAAGTGCTAATGATGTCCACTCAGACCAGAGATGAAAAC
CCATTTGCCAGTCTGACAGCCACATCACAGCCAATTGCTGCAGCAGCACGGTCACCAGAC
AGAAATCTCTTGCTAAACACTGGCTCCAATCCAGGAACAAGCCCCATGTTCTGCAGCGTG
GCTTCCTTTGGTGCCAGCTCTTTGTCTAGCCTCTATGAAAGTAGTCCGGCTCCCACTCCC
AGTTTCTGGAGCTCTGTTCCCGTGATGGGCCCGTCTCTTGCCTCACCTTCCCGTGCAGCC
AGCCAGTTGGCTGTGCCTTCCACTCCCCTCAGTCCTCACAGTGCAGCCTCTGGAACTGCT
GCGGGAAGCCAGCCTTCATCCCCGCGGTATCGCCCCTACACTGTCACTCACCCATGGGCG
TCCTCAGGCGTCTCCATTCTGTCGAGCTCCCCAAGTCCCCCTGCCCTCGCCAGTAGCCCC
CAAGCAGTGCCCGCCAGCAGTTCCAGACAGAGGCCCAGCAGCACGGGTCCACCCCTACCA
CCCGCCTCACCCAGTGCCACGAGCAGACGCCCCTCCTCCCTGAGGATCTCTCCTAGTTTG
GGAGCCTCTGGTGGAGCAAGTAATTGGGATTCCTACAGTGACCATTTCACCATTGAAACC
TGCAAAGAGACAGATATGCTGAACTACCTCATCGAGTGTTTCGACCGAGTTGGAATAGAG
GAAAAAAAAGCACCAAAGATGTGCAGCCAGCCAGCAGTCAGCCAGCTTCTGAGCAACATC
CGCTCACAGTGCATATCCCATACTGCTTTAGTACTACAAGGCTCCCTAACACAGCCCAGG
TCCTTGCAGCAGCCGTCCTTCCTAGTGCCGTATATGCTGTGTAGGAATCTCCCATATGGC
TTCATTCAGGAACTGGTGAGAACCACTCACCAGGATGAAGAAGTGTTCAAGCAGATATTT
ATCCCCATTTTACAAGGCCTGGCTCTTGCTGCCAAAGAGTGCTCCCTCGACAGTGACTAC
TTTAAATACCCCCTCATGGCACTAGGTGAGCTCTGTGAAACCAAGTTTGGGAAGACACAC
CCTGTGTGCAATTTGGTTGCTTCTTTGCGGTTGTGGTTGCCGAAATCCTTAAGTCCTGGC
TGTGGGCGGGAGCTGCAGAGACTCTCTTACTTAGGGGCTTTCTTTAGCTTCTCAGTCTTT
GCAGAAGATGATGTTAAAGTGGTTGAAAAATACTTCTCAGGGCCTGCCATTACCCTGGAA
AACACTCGTGTGGTTAGCCAATCATTGCAGCATTACTTAGAGCTCGGAAGGCAAGAGCTT
TTTAAGATTCTGCATAGTATTTTGTTAAATGGCGAAACCCGTGAGGCTGCTCTCAGTTAC
ATGGCGGCTGTCGTCAATGCCAATATGAAGAAAGCACAGATGCAGACAGATGATAGATTG
GTGTCTACAGATGGATTTATGCTGAATTTCCTTTGGGTACTGCAGCAGCTAAGTACAAAA
ATCAAGTTAGAAACAGTTGATCCCACGTATATTTTTCACCCAAGATGTCGGATTACTCTT
CCCAATGATGAGACGCGTGTGAATGCAACGATGGAAGATGTGAATGACTGGCTGACTGAA
CTCTATGGCGATCAGCCTCCATTTTCTGAGCCGAAATTCCCTACGGAGTGCTTCTTTCTC
ACCCTGCATGCTCACCACCTCTCTATTCTGCCTAGTTGCCGTCGCTATATCCGCAGACTC
CGGGCTATCCGGGAGCTCAATAGAACTGTAGAAGATTTGAAAAATAATGAAAGCCAATGG
AAAGATTCCCCACTGGCAACTAGACACCGCGAAATGCTGAAGCGCTGTAAAACTCAGCTT
AAGAAACTGGTACGGTGCAAGGCCTGTGCTGATGCTGGCCTACTTGACGAGAGCTTCCTG
AGAAGATGTCTGAATTTTTATGGCCTTCTCATTCAGCTGCTGCTCCGCATCCTGGACCCC
GCATATCCCGATATAACACTGCCTTTAAATTCAGATGTCCCCAAGGTATTTGCAGCGTTG
CCTGAGTTTTATGTAGAAGATGTTGCAGAATTTTTATTTTTTATTGTACAATACTCTCCC
CAGGCGCTTTATGAGCCCTGTACTCAGGATATTGTGATGTTCCTTGTTGTGATGTTGTGC
AACCAGAACTACATCCGAAACCCATATTTGGTGGCCAAACTGGTAGAAGTCATGTTTATG
ACCAACCCTGCTGTTCAGCCACGAACCCAGAAGTTTTTTGAAATGATTGAGAACCATCCT
CTCTCCACCAAGTTGTTGGTACCTTCCCTGATGAAGTTTTATACAGATGTTGAGCATACC
GGAGCCACCAGTGAGTTTTATGACAAGTTCACAATTCGCTATCATATTAGCACCATTTTT
AAAAGCCTTTGGCAAAACATAGCTCACCATGGCACCTTTATGGAGGAGTTCAACTCCGGG
AAGCAGTTTGTTCGCTATATAAACATGTTGATAAACGACACGACGTTTTTGCTCGATGAA
AGTCTGGAGTCTCTGAAGCGAATCCATGAAGTGCAGGAAGAGATGAAGAACAAAGAACAG
TGGGACCAGTTGCCCCGGGATCAGCAGCAGGCTCGTCAGTCTCAGCTTGCTCAGGATGAG
CGTGTGTCCCGCTCTTACCTCGCCCTGGCCACCGAAACCGTGGACATGTTCCACATCCTC
ACGAAGCAGGTCCAGAAGCCCTTCCTCAGACCGGAGCTTGGACCCCGATTGGCTGCAATG
CTGAACTTTAATCTTCAGCAACTTTGTGGCCCCAAGTGCCGTGACCTGAAAGTTGAAAAC
CCTGAGAAATACGGCTTTGAACCAAAGAAGCTGTTGGACCAACTGACGGATATTTACTTA
CAGCTGGACTGTGCTCGGTTCGCGAAAGCCATTGCTGACGACCAGAGATCCTACAGTAAG
GAATTGTTTGAAGAAGTTATTTCAAAGATGCGGAAGGCAGGGATCAAATCCACAATAGCA
ATAGAAAAATTTAAGCTGCTCGCCGAGAAAGTGGAGGAGATAGTGGCCAAGAACGCACGC
GCAGAAATCGACTACAGCGACGCTCCTGATGAGTTCAGAGACCCTCTGATGGACACCCTC
ATGACAGACCCCGTGCGGCTGCCCTCTGGCACCATCATGGACCGCTCCATCATCCTGCGG
CACCTGCTCAACTCCCCCACGGACCCCTTCAACCGGCAGACGCTGACAGAGAGCATGCTG
GAACCAGTGCCAGAACTGAAAGAGCAGATTCAGGCGTGGATGAGAGAGAAACAGAACAGC
GATCACTAA
Protein Properties
Number of Residues 1302
Molecular Weight 146183.2
Theoretical pI 6.52
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ubiquitin conjugation factor E4 B
MEELSADEIRRRRLARLAGGQTSQPTTPLTSPQRENPPGPPIAASAPGPSQSLGLNVHNM
TPATSPIGASGVAHRSQSSEGVSSLSSSPSNSLETQSQSLSRSQSMDIDGVSCEKSMSQV
DVDSGIENMEVDENDRREKRSLSDKEPSSGPEVSEEQALQLVCKIFRVSWKDRDRDVIFL
SSLSAQFKQNPKEVFSDFKDLIGQILMEVLMMSTQTRDENPFASLTATSQPIAAAARSPD
RNLLLNTGSNPGTSPMFCSVASFGASSLSSLYESSPAPTPSFWSSVPVMGPSLASPSRAA
SQLAVPSTPLSPHSAASGTAAGSQPSSPRYRPYTVTHPWASSGVSILSSSPSPPALASSP
QAVPASSSRQRPSSTGPPLPPASPSATSRRPSSLRISPSLGASGGASNWDSYSDHFTIET
CKETDMLNYLIECFDRVGIEEKKAPKMCSQPAVSQLLSNIRSQCISHTALVLQGSLTQPR
SLQQPSFLVPYMLCRNLPYGFIQELVRTTHQDEEVFKQIFIPILQGLALAAKECSLDSDY
FKYPLMALGELCETKFGKTHPVCNLVASLRLWLPKSLSPGCGRELQRLSYLGAFFSFSVF
AEDDVKVVEKYFSGPAITLENTRVVSQSLQHYLELGRQELFKILHSILLNGETREAALSY
MAAVVNANMKKAQMQTDDRLVSTDGFMLNFLWVLQQLSTKIKLETVDPTYIFHPRCRITL
PNDETRVNATMEDVNDWLTELYGDQPPFSEPKFPTECFFLTLHAHHLSILPSCRRYIRRL
RAIRELNRTVEDLKNNESQWKDSPLATRHREMLKRCKTQLKKLVRCKACADAGLLDESFL
RRCLNFYGLLIQLLLRILDPAYPDITLPLNSDVPKVFAALPEFYVEDVAEFLFFIVQYSP
QALYEPCTQDIVMFLVVMLCNQNYIRNPYLVAKLVEVMFMTNPAVQPRTQKFFEMIENHP
LSTKLLVPSLMKFYTDVEHTGATSEFYDKFTIRYHISTIFKSLWQNIAHHGTFMEEFNSG
KQFVRYINMLINDTTFLLDESLESLKRIHEVQEEMKNKEQWDQLPRDQQQARQSQLAQDE
RVSRSYLALATETVDMFHILTKQVQKPFLRPELGPRLAAMLNFNLQQLCGPKCRDLKVEN
PEKYGFEPKKLLDQLTDIYLQLDCARFAKAIADDQRSYSKELFEEVISKMRKAGIKSTIA
IEKFKLLAEKVEEIVAKNARAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILR
HLLNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNSDH
GenBank ID Protein 157739864
UniProtKB/Swiss-Prot ID O95155
UniProtKB/Swiss-Prot Entry Name UBE4B_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001105562.2
GeneCard ID UBE4B
GenAtlas ID UBE4B
HGNC ID HGNC:12500
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  6. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  7. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  8. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  9. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  10. Onyango P, Lubyova B, Gardellin P, Kurzbauer R, Weith A: Molecular cloning and expression analysis of five novel genes in chromosome 1p36. Genomics. 1998 Jun 1;50(2):187-98. [PubMed:9653645 ]
  11. Ishikawa K, Nagase T, Suyama M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1998 Jun 30;5(3):169-76. [PubMed:9734811 ]
  12. Ohira M, Kageyama H, Mihara M, Furuta S, Machida T, Shishikura T, Takayasu H, Islam A, Nakamura Y, Takahashi M, Tomioka N, Sakiyama S, Kaneko Y, Toyoda A, Hattori M, Sakaki Y, Ohki M, Horii A, Soeda E, Inazawa J, Seki N, Kuma H, Nozawa I, Nakagawara A: Identification and characterization of a 500-kb homozygously deleted region at 1p36.2-p36.3 in a neuroblastoma cell line. Oncogene. 2000 Aug 31;19(37):4302-7. [PubMed:10980605 ]
  13. Mahoney JA, Odin JA, White SM, Shaffer D, Koff A, Casciola-Rosen L, Rosen A: The human homologue of the yeast polyubiquitination factor Ufd2p is cleaved by caspase 6 and granzyme B during apoptosis. Biochem J. 2002 Feb 1;361(Pt 3):587-95. [PubMed:11802788 ]