You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09303
Secondary Accession Numbers
  • 15134
Name Ubiquitin-conjugating enzyme E2 O
Synonyms
  1. Ubiquitin carrier protein O
  2. Ubiquitin-conjugating enzyme E2 of 230 kDa
  3. Ubiquitin-conjugating enzyme E2-230K
  4. Ubiquitin-protein ligase O
Gene Name UBE2O
Protein Type Enzyme
Biological Properties
General Function Involved in acid-amino acid ligase activity
Specific Function Catalyzes the covalent attachment of ubiquitin to other proteins (By similarity).
Pathways
  • protein ubiquitination
  • Ubiquitin mediated proteolysis
Reactions
Adenosine triphosphate + ubiquitin + protein lysine → Adenosine monophosphate + Pyrophosphate + protein N-ubiquityllysine details
GO Classification
Function
catalytic activity
small conjugating protein ligase activity
ligase activity
ligase activity, forming carbon-nitrogen bonds
acid-amino acid ligase activity
Molecular Function
ubiquitin-protein ligase activity
ATP binding
Process
metabolic process
regulation of protein metabolic process
macromolecule metabolic process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
post-translational protein modification
macromolecule modification
protein modification process
Cellular Location Not Available
Gene Properties
Chromosome Location 17
Locus 17q25.1
SNPs UBE2O
Gene Sequence
>3879 bp
ATGGCGGATCCCGCAGCCCCCACGCCCGCAGCTCCCGCTCCAGCCCAGGCCCCGGCTCCA
GCCCCGGAGGCAGTCCCGGCCCCAGCCGCAGCCCCCGTCCCGGCGCCGGCGCCCGCCTCG
GACTCGGCCTCCGGGCCGTCCTCGGACTCCGGCCCAGAAGCCGGCTCGCAGCGCCTGCTG
TTTTCTCACGACCTGGTGTCGGGCCGTTACCGTGGCTCCGTGCACTTCGGGCTGGTGCGC
CTCATCCACGGCGAGGACTCGGACTCGGAGGGCGAGGAGGAGGGCCGCGGGAGCTCGGGG
TGCTCCGAGGCCGGGGGCGCGGGCCACGAGGAGGGCCGGGCCAGCCCCCTGCGCCGCGGC
TACGTGCGCGTCCAGTGGTACCCGGAGGGCGTCAAGCAGCATGTGAAGGAGACCAAGCTG
AAACTAGAGGACCGTTCTGTGGTGCCCCGAGATGTGGTCCGGCACATGCGATCCACCGAC
AGTCAGTGTGGCACGGTGATCGACGTCAACATCGACTGTGCCGTCAAGCTCATCGGCACC
AACTGCATCATCTATCCCGTCAACAGCAAGGACCTGCAGCACATCTGGCCCTTCATGTAT
GGGGACTACATTGCCTATGACTGCTGGCTGGGGAAGGTCTACGACTTGAAGAACCAGATC
ATCCTGAAGCTATCCAACGGCGCCAGGTGCTCCATGAACACGGAAGATGGCGCCAAGCTC
TACGACGTCTGCCCGCACGTCAGCGACTCGGGTCTCTTCTTCGATGATTCCTATGGCTTC
TACCCAGGCCAGGTGCTCATTGGCCCTGCCAAGATCTTCTCCAGCGTCCAGTGGCTGTCA
GGTGTCAAGCCCGTGCTCAGCACCAAGAGCAAGTTCCGAGTGGTGGTGGAAGAGGTGCAG
GTTGTAGAGTTGAAAGTTACATGGATTACCAAGAGTTTCTGTCCAGGGGGCACGGACAGC
GTCAGCCCCCCACCCTCTGTCATCACCCAGGAAAACCTAGGCAGGGTGAAGCGTCTCGGA
TGCTTTGACCATGCTCAGCGGCAGCTTGGGGAGCGCTGTCTGTATGTCTTCCCAGCCAAG
GTAGAGCCAGCCAAGATTGCCTGGGAATGTCCAGAAAAAAACTGCGCCCAGGGGGAGGGC
TCTATGGCCAAGAAGGTGAAGCGCCTGTTGAAGAAGCAGGTTGTGCGGATCATGTCATGC
TCCCCAGACACCCAGTGTTCCCGGGACCATTCCATGGAAGACCCAGACAAGAAGGGGGAA
TCCAAAACCAAGAGCGAAGCGGAGTCTGCCAGCCCTGAGGAGACGCCCGATGGCTCTGCC
AGTCCAGTGGAGATGCAGGACGAGGGTGCAGAGGAGCCCCACGAGGCAGGAGAGCAGCTG
CCCCCATTCCTGCTAAAAGAAGGCAGAGATGACAGGCTGCACTCGGCAGAGCAGGACGCA
GATGATGAGGCTGCTGATGACACGGACGACACCAGTTCGGTGACCTCCTCTGCCAGCTCC
ACCACTTCCTCCCAGAGCGGCAGCGGCACGAGTCGCAAAAAGAGCATCCCCTTGTCCATC
AAGAACTTAAAGCGCAAACACAAGAGGAAGAAGAATAAAATCACTCGAGACTTCAAGCCA
GGGGACAGGGTGGCAGTGGAGGTGGTGACCACGATGACCTCAGCCGACGTGATGTGGCAG
GATGGCTCCGTGGAATGCAACATCCGCTCCAACGACCTCTTCCCTGTGCACCACCTGGAC
AACAACGAGTTCTGCCCTGGAGACTTCGTGGTAGATAAGCGAGTCCAGAGCTGTCCAGAC
CCTGCTGTCTACGGTGTGGTACAGTCTGGGGACCACATCGGCCGTACCTGCATGGTGAAG
TGGTTCAAGCTGAGGCCGAGTGGGGACGACGTGGAGCTGATTGGAGAAGAGGAAGATGTG
AGTGTTTACGACATTGCTGACCACCCTGACTTTAGGTTCCGTACAACTGACATCGTCATC
CGCATCGGCAATACTGAGGATGGGGCTCCTCACAAGGAGGATGAGCCATCGGTGGGCCAG
GTGGCCCGTGTGGACGTCAGCAGCAAGGTGGAGGTGGTGTGGGCTGACAACTCAAAGACC
ATCATCCTGCCCCAGCACTTGTACAACATAGAGTCTGAGATTGAGGAGTCAGACTACGAT
TCGGTAGAAGGCAGCACCAGCGGGGCATCCTCGGATGAATGGGAAGATGATAGTGACAGC
TGGGAGACGGACAATGGGCTGGTGGAGGACGAGCACCCCAAGATAGAGGAGCCCCCCATC
CCACCCCTGGAGCAGCCGGTGGCCCCTGAGGACAAGGGAGTGGTGATCAGTGAAGAGGCA
GCCACAGCTGCCGTCCAGGGGGCTGTGGCCATGGCTGCCCCCATGGCCGGGCTGATGGAG
AAGGCTGGCAAGGACGGGCCACCCAAGAGCTTCCGGGAGTTGAAAGAGGCCATCAAGATC
CTGGAGAGCCTCAAGAACATGACTGTGGAGCAGCTGCTGACGGGCTCGCCCACCTCTCCG
ACTGTGGAGCCTGAGAAGCCAACTCGGGAGAAGAAGTTTCTGGATGACATCAAGAAGCTA
CAGGAAAACCTCAAGAAGACCCTGGACAATGTGGCCATTGTAGAGGAGGAGAAGATGGAA
GCAGTGCCCGACGTAGAGCGCAAGGAGGACAAGCCCGAGGGGCAGTCACCTGTGAAGGCT
GAGTGGCCCAGCGAAACCCCGGTGCTGTGCCAGCAGTGTGGCGGCAAGCCTGGCGTCACC
TTCACCAGCGCCAAGGGCGAGGTCTTCTCCGTACTGGAGTTTGCACCCTCAAATCATTCT
TTTAAGAAAATTGAGTTCCAGCCTCCAGAAGCCAAGAAGTTCTTCAGCACAGTGCGGAAG
GAGATGGCGCTGCTGGCTACCTCACTGCCTGAGGGCATCATGGTCAAGACTTTTGAAGAT
AGAATGGACCTCTTCTCAGCTCTCATCAAGGGCCCCACTCGAACCCCCTACGAGGATGGC
CTCTACTTGTTTGACATCCAGCTCCCCAACATCTACCCAGCCGTGCCCCCCCACTTCTGC
TACCTCTCCCAATGCAGTGGCCGCCTGAACCCCAACCTGTATGACAATGGGAAGGTGTGT
GTCAGCCTCCTGGGCACCTGGATTGGAAAGGGGACAGAGAGGTGGACAAGCAAGTCCAGC
CTTCTCCAGGTGCTCATCTCCATCCAAGGTCTGATCCTGGTAAATGAACCATACTACAAC
GAAGCCGGCTTCGACAGTGACCGAGGCCTGCAGGAAGGCTATGAAAACAGTCGCTGTTAC
AATGAGATGGCGCTGATCCGCGTGGTGCAGTCCATGACCCAGCTGGTGCGGCGGCCCCCC
GAGGTCTTTGAGCAGGAGATCAGGCAACACTTTAGCACTGGTGGCTGGCGGCTGGTGAAC
CGTATCGAGTCCTGGCTGGAAACCCATGCCCTGCTGGAGAAGGCCCAGGCACTGCCCAAC
GGGGTGCCCAAGGCCAGCAGCTCGCCAGAGCCCCCAGCTGTAGCCGAGCTGTCAGACTCC
GGCCAACAAGAACCTGAGGATGGAGGGCCAGCCCCAGGAGAGGCCTCCCAGGGCTCAGAC
TCAGAGGGCGGTGCCCAGGGCCTGGCCTCAGCTAGCAGGGACCACACAGACCAGACTTCG
GAGACCGCACCAGACGCATCGGTGCCACCCAGTGTGAAACCAAAGAAGCGGAGAAAGAGC
TACCGGAGCTTCTTACCTGAGAAGAGTGGCTACCCTGACATCGGCTTCCCCCTCTTCCCA
CTTTCCAAGGGTTTCATCAAGAGCATCCGGGGTGTCCTGACGCAGTTCCGGGCTGCCCTG
CTAGAGGCAGGCATGCCGGAGTGCACAGAGGACAAGTAG
Protein Properties
Number of Residues 1292
Molecular Weight 141292.265
Theoretical pI 5.125
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Ubiquitin-conjugating enzyme E2 O
MADPAAPTPAAPAPAQAPAPAPEAVPAPAAAPVPAPAPASDSASGPSSDSGPEAGSQRLL
FSHDLVSGRYRGSVHFGLVRLIHGEDSDSEGEEEGRGSSGCSEAGGAGHEEGRASPLRRG
YVRVQWYPEGVKQHVKETKLKLEDRSVVPRDVVRHMRSTDSQCGTVIDVNIDCAVKLIGT
NCIIYPVNSKDLQHIWPFMYGDYIAYDCWLGKVYDLKNQIILKLSNGARCSMNTEDGAKL
YDVCPHVSDSGLFFDDSYGFYPGQVLIGPAKIFSSVQWLSGVKPVLSTKSKFRVVVEEVQ
VVELKVTWITKSFCPGGTDSVSPPPSVITQENLGRVKRLGCFDHAQRQLGERCLYVFPAK
VEPAKIAWECPEKNCAQGEGSMAKKVKRLLKKQVVRIMSCSPDTQCSRDHSMEDPDKKGE
SKTKSEAESASPEETPDGSASPVEMQDEGAEEPHEAGEQLPPFLLKEGRDDRLHSAEQDA
DDEAADDTDDTSSVTSSASSTTSSQSGSGTSRKKSIPLSIKNLKRKHKRKKNKITRDFKP
GDRVAVEVVTTMTSADVMWQDGSVECNIRSNDLFPVHHLDNNEFCPGDFVVDKRVQSCPD
PAVYGVVQSGDHIGRTCMVKWFKLRPSGDDVELIGEEEDVSVYDIADHPDFRFRTTDIVI
RIGNTEDGAPHKEDEPSVGQVARVDVSSKVEVVWADNSKTIILPQHLYNIESEIEESDYD
SVEGSTSGASSDEWEDDSDSWETDNGLVEDEHPKIEEPPIPPLEQPVAPEDKGVVISEEA
ATAAVQGAVAMAAPMAGLMEKAGKDGPPKSFRELKEAIKILESLKNMTVEQLLTGSPTSP
TVEPEKPTREKKFLDDIKKLQENLKKTLDNVAIVEEEKMEAVPDVERKEDKPEGQSPVKA
EWPSETPVLCQQCGGKPGVTFTSAKGEVFSVLEFAPSNHSFKKIEFQPPEAKKFFSTVRK
EMALLATSLPEGIMVKTFEDRMDLFSALIKGPTRTPYEDGLYLFDIQLPNIYPAVPPHFC
YLSQCSGRLNPNLYDNGKVCVSLLGTWIGKGTERWTSKSSLLQVLISIQGLILVNEPYYN
EAGFDSDRGLQEGYENSRCYNEMALIRVVQSMTQLVRRPPEVFEQEIRQHFSTGGWRLVN
RIESWLETHALLEKAQALPNGVPKASSSPEPPAVAELSDSGQQEPEDGGPAPGEASQGSD
SEGGAQGLASASRDHTDQTSETAPDASVPPSVKPKKRRKSYRSFLPEKSGYPDIGFPLFP
LSKGFIKSIRGVLTQFRAALLEAGMPECTEDK
GenBank ID Protein 192449449
UniProtKB/Swiss-Prot ID Q9C0C9
UniProtKB/Swiss-Prot Entry Name UBE2O_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_022066.3
GeneCard ID UBE2O
GenAtlas ID UBE2O
HGNC ID HGNC:29554
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  6. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196 ]
  7. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  8. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  9. Molina H, Horn DM, Tang N, Mathivanan S, Pandey A: Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry. Proc Natl Acad Sci U S A. 2007 Feb 13;104(7):2199-204. Epub 2007 Feb 7. [PubMed:17287340 ]
  10. Nagase T, Kikuno R, Hattori A, Kondo Y, Okumura K, Ohara O: Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Dec 31;7(6):347-55. [PubMed:11214970 ]
  11. Yokota T, Nagai H, Harada H, Mine N, Terada Y, Fujiwara H, Yabe A, Miyazaki K, Emi M: Identification, tissue expression, and chromosomal position of a novel gene encoding human ubiquitin-conjugating enzyme E2-230k. Gene. 2001 Apr 4;267(1):95-100. [PubMed:11311559 ]