You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09382
Secondary Accession Numbers
  • 15251
Name tRNA isopentenyltransferase 1 variant
Synonyms Not Available
Gene Name TRIT1
Protein Type Enzyme
Biological Properties
General Function Involved in ATP binding
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
Process
rna metabolic process
ncrna metabolic process
trna metabolic process
trna processing
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 1p34.2
SNPs TRIT1
Gene Sequence
>1404 bp
ATGGCGTCCGTGGCGGCTGCACGAGCAGTTCCCGTGGGCAGTGGGCTCAGGGGCCTGCAA
CGGACCCTACCTCTTGTAGTGATTCTCGGGGCCACGGGCACCGGCAAATCCACGCTGGCG
TTGCAGCTAGGCCAGCGGCTCGGCGGTGAGATCGTCAGCGCTGACTCCATGCAGGTCTAT
GAAGGCCTAGACATCATCACCAACAAGGTTTCTGCCCAAGAGCAGAGAATCTGCCGGCAC
CACATGATCAGCTTTGTGGATCCTCTTGTGACCAATTACACAGTGGTGGACTTCAGAAAT
AGAGCAACTGCTCTGATTGAAGATATATTTGCCCGAGACAAAATTCCTATTGTTGTGGGA
GGAACCAATTATTACATTGAATCTCTGCTCTGGAAAGTTCTTGTCAATACCAAGCCCCAG
GAGATGGGCACTGAGAAAGTGATTGACCGAAAAGTGGAGCTTGAAAAGGAGGATGGTCTT
GTACTTCACAAACGCCTAAGCCAGGTGGACCCAGAAATGGCTGCCAAGCTGCATCCACAT
GACAAACGCAAAGTGGCCAGGAGCTTGCAAGTTTTTGAAGAAACAGGAATCTCTCATAGT
GAATTTCTCCATCGTCAACATACGGAAGAAGGTGGTGGTCCCCTTGGAGGTCCTCTGAAG
TTCTCTAACCCTTGCATCCTTTGGCTTCATGCTGACCAGGCAGTTCTAGATGAGCGCTTG
GATAAGAGGGTGGATGACATGCTTGCTGCTGGGCTCTTGGAGGAACTAAGAGATTTTCAC
AGACGCTATAATCAGAAGAATGTTTCGGAAAATAGCCAGGACTATCAACATGGTATCTTC
CAATCAATTGGCTTCAAGGAATTTCACGAGTACCTGATCACTGAGGGAAAATGCACACTG
GAGACTAGTAACCAGCTTCTAAAGAAAGGTATTGAGGCTCTGAAACAAGTAACTAAGAGA
TATGCCCGGAAACAAAACCGATGGGTTAAAAACCGTTTTTTGAGCAGACCTGGTCCCATT
GTCCCCCCTGTCTATGGCTTAGAGGTATCTGATGTCTCGAAGTGGGAAGAGTCTGTTCTT
GAACCTGCTCTTGAAATCGTGCAAAGTTTCATCCAGGGCCACAAGCCTACAGCCACTCCA
ATAAAGATGCCATACAATGAAGCTGAGAACAAGAGAAGTTATCACCTGTGTGACCTCTGT
GATCGAATCATCATTGGGGATCGCGAATGGGCAGCGCACATAAAATCCAAATCCCACTTG
AACCAACTGAAGAAAAGAAGAAGATTGGACTCAGATGCTGTCAACACCATAGAAAGTCAG
AGTGTTTCCCCAGACCATAACAAAGAACCTAAAGAGAAGGGATCCCCAGGGCAGAATGAT
CAAGAGCTGATGTGCAGCGTTTAA
Protein Properties
Number of Residues 467
Molecular Weight 52727.9
Theoretical pI 8.16
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>tRNA isopentenyltransferase 1 variant
MASVAAARAVPVGSGLRGLQRTLPLVVILGATGTGKSTLALQLGQRLGGEIVSADSMQVY
EGLDIITNKVSAQEQRICRHHMISFVDPLVTNYTVVDFRNRATALIEDIFARDKIPIVVG
GTNYYIESLLWKVLVNTKPQEMGTEKVIDRKVELEKEDGLVLHKRLSQVDPEMAAKLHPH
DKRKVARSLQVFEETGISHSEFLHRQHTEEGGGPLGGPLKFSNPCILWLHADQAVLDERL
DKRVDDMLAAGLLEELRDFHRRYNQKNVSENSQDYQHGIFQSIGFKEFHEYLITEGKCTL
ETSNQLLKKGIEALKQVTKRYARKQNRWVKNRFLSRPGPIVPPVYGLEVSDVSKWEESVL
EPALEIVQSFIQGHKPTATPIKMPYNEAENKRSYHLCDLCDRIIIGDREWAAHIKSKSHL
NQLKKRRRLDSDAVNTIESQSVSPDHNKEPKEKGSPGQNDQELMCSV
GenBank ID Protein 62898688
UniProtKB/Swiss-Prot ID Q53F11
UniProtKB/Swiss-Prot Entry Name Q53F11_HUMAN
PDB IDs Not Available
GenBank Gene ID AK223478
GeneCard ID TRIT1
GenAtlas ID TRIT1
HGNC ID HGNC:20286
References
General References
  1. Maruyama K, Sugano S: Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides. Gene. 1994 Jan 28;138(1-2):171-4. [PubMed:8125298 ]
  2. Suzuki Y, Yoshitomo-Nakagawa K, Maruyama K, Suyama A, Sugano S: Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library. Gene. 1997 Oct 24;200(1-2):149-56. [PubMed:9373149 ]