Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10791
Secondary Accession Numbers
  • 17063
Name Chondroitin sulfate proteoglycan 4
Synonyms
  1. Chondroitin sulfate proteoglycan NG2
  2. Melanoma chondroitin sulfate proteoglycan
  3. Melanoma-associated chondroitin sulfate proteoglycan
Gene Name CSPG4
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Proteoglycan playing a role in cell proliferation and migration which stimulates endothelial cells motility during microvascular morphogenesis. May also inhibit neurite outgrowth and growth cone collapse during axon regeneration. Cell surface receptor for collagen alpha 2(VI) which may confer cells ability to migrate on that substrate. Binds through its extracellular N- terminus growth factors, extracellular matrix proteases modulating their activity. May regulate MPP16-dependent degradation and invasion of type I collagen participating in melanoma cells invasion properties. May modulate the plasminogen system by enhancing plasminogen activation and inhibiting angiostatin. Functions also as a signal transducing protein by binding through its cytoplasmic C-terminus scaffolding and signaling proteins. May promote retraction fiber formation and cell polarization through Rho GTPase activation. May stimulate alpha-4, beta-1 integrin- mediated adhesion and spreading by recruiting and activating a signaling cascade through CDC42, ACK1 and BCAR1. May activate FAK and ERK1/ERK2 signaling cascades
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Single-pass type I membrane protein
  2. Single-pass type I membrane protein
  3. Extracellular side
  4. Extracellular side
  5. Apical cell membrane
  6. Cell projection
  7. lamellipodium membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 15q24.2
SNPs CSPG4
Gene Sequence
>6969 bp
ATGCAGTCCGGGCCGCGGCCCCCACTTCCAGCCCCCGGCCTGGCCTTGGCTTTGACCCTG
ACTATGTTGGCCAGACTTGCATCCGCGGCTTCCTTCTTCGGTGAGAACCACCTGGAGGTG
CCTGTGGCCACGGCTCTGACCGACATAGACCTGCAGCTGCAGTTCTCCACGTCCCAGCCC
GAAGCCCTCCTTCTCCTGGCAGCAGGCCCAGCTGACCACCTCCTGCTGCAGCTCTACTCT
GGACGCCTGCAGGTCAGACTTGTTCTGGGCCAGGAGGAGCTGAGGCTGCAGACTCCAGCA
GAGACGCTGCTGAGTGACTCCATCCCCCACACTGTGGTGCTGACTGTCGTAGAGGGCTGG
GCCACGTTGTCAGTCGATGGGTTTCTGAACGCCTCCTCAGCAGTCCCAGGAGCCCCCCTA
GAGGTCCCCTATGGGCTCTTTGTTGGGGGCACTGGGACCCTTGGCCTGCCCTACCTGAGG
GGAACCAGCCGACCCCTGAGGGGTTGCCTCCATGCAGCCACCCTCAATGGCCGCAGCCTC
CTCCGGCCTCTGACCCCCGATGTGCATGAGGGCTGTGCTGAAGAGTTTTCTGCCAGTGAT
GATGTGGCCCTGGGCTTCTCTGGGCCCCACTCTCTGGCTGCCTTCCCTGCCTGGGGCACT
CAGGACGAAGGAACCCTAGAGTTTACACTCACCACACAGAGCCGGCAGGCACCCTTGGCC
TTCCAGGCAGGGGGCCGGCGTGGGGACTTCATCTATGTGGACATATTTGAGGGCCACCTG
CGGGCCGTGGTGGAGAAGGGCCAGGGTACCGTATTGCTCCACAACAGTGTGCCTGTGGCC
GATGGGCAGCCCCATGAGGTCAGTGTCCACATCAATGCTCACCGGCTGGAAATCTCCGTG
GACCAGTACCCTACGCATACTTCGAACCGAGGAGTCCTCAGCTACCTGGAGCCACGGGGC
AGTCTCCTTCTCGGGGGGCTGGATGCAGAGGCCTCTCGTCACCTCCAGGAACACCGCCTG
GGCCTGACACCAGAGGCCACCAATGCCTCCCTGCTGGGCTGCATGGAAGACCTCAGTGTC
AATGGCCAGAGGCGGGGGCTGCGGGAAGCTTTGCTGACGCGCAACATGGCAGCCGGCTGC
AGGCTGGAGGAGGAGGAGTATGAGGACGATGCCTATGGACATTATGAAGCTTTCTCCACC
CTGGCCCCTGAGGCTTGGCCAGCCATGGAGCTGCCTGAGCCATGCGTGCCTGAGCCAGGG
CTGCCTCCTGTCTTTGCCAATTTCACCCAGCTGCTGACTATCAGCCCACTGGTGGTGGCC
GAGGGGGGCACAGCCTGGCTTGAGTGGAGGCATGTGCAGCCCACGCTGGACCTGATGGAG
GCTGAGCTGCGCAAATCCCAGGTGCTGTTCAGCGTGACCCGAGGGGCACGCCATGGCGAG
CTCGAGCTGGACATCCCGGGAGCCCAGGCACGAAAAATGTTCACCCTCCTGGACGTGGTG
AACCGCAAGGCCCGCTTCATCCACGATGGCTCTGAGGACACCTCCGACCAGCTGGTGCTG
GAGGTGTCGGTGACGGCTCGGGTGCCCATGCCCTCATGCCTTCGGAGGGGCCAAACATAC
CTCCTGCCCATCCAGGTCAACCCTGTCAATGACCCACCCCACATCATCTTCCCACATGGC
AGCCTCATGGTGATCCTGGAACACACGCAGAAGCCGCTGGGGCCTGAGGTTTTCCAGGCC
TATGACCCGGACTCTGCCTGTGAGGGCCTCACCTTCCAGGTCCTTGGCACCTCCTCTGGC
CTCCCCGTGGAGCGCCGAGACCAGCCTGGGGAGCCGGCGACCGAGTTCTCCTGCCGGGAG
TTGGAGGCCGGCAGCCTAGTCTATGTCCACCGCGGTGGTCCTGCACAGGACTTGACGTTC
CGGGTCAGCGATGGACTGCAGGCCAGCCCCCCGGCCACGCTGAAGGTGGTGGCCATCCGG
CCGGCCATACAGATCCACCGCAGCACAGGGTTGCGACTGGCCCAAGGCTCTGCCATGCCC
ATCTTGCCCGCCAACCTGTCGGTGGAGACCAATGCCGTGGGGCAGGATGTGAGCGTGCTG
TTCCGCGTCACTGGGGCCCTGCAGTTTGGGGAGCTGCAGAAGCAGGGGGCAGGTGGGGTG
GAGGGTGCTGAGTGGTGGGCCACACAGGCGTTCCACCAGCGGGATGTGGAGCAGGGCCGC
GTGAGGTACCTGAGCACTGACCCACAGCACCACGCTTACGACACCGTGGAGAACCTGGCC
CTGGAGGTGCAGGTGGGCCAGGAGATCCTGAGCAATCTGTCCTTCCCAGTGACCATCCAG
AGAGCCACTGTGTGGATGCTGCGGCTGGAGCCACTGCACACTCAGAACACCCAGCAGGAG
ACCCTCACCACAGCCCACCTGGAGGCCACCCTGGAGGAGGCAGGCCCAAGCCCCCCAACC
TTCCATTATGAGGTGGTTCAGGCTCCCAGGAAAGGCAACCTTCAACTACAGGGCACAAGG
CTGTCAGATGGCCAGGGCTTCACCCAGGATGACATACAGGCTGGCCGGGTGACCTATGGG
GCCACAGCACGTGCCTCAGAGGCAGTCGAGGACACCTTCCGTTTCCGTGTCACAGCTCCA
CCATATTTCTCCCCACTCTATACCTTCCCCATCCACATTGGTGGTGACCCAGATGCGCCT
GTCCTCACCAATGTCCTCCTCGTGGTGCCTGAGGGTGGTGAGGGTGTCCTCTCTGCTGAC
CACCTCTTTGTCAAGAGTCTCAACAGTGCCAGCTACCTCTATGAGGTCATGGAGCGGCCC
CGCCATGGGAGGTTGGCTTGGCGTGGGACACAGGACAAGACCACTATGGTGACATCCTTC
ACCAATGAAGACCTGTTGCGTGGCCGGCTGGTCTACCAGCATGATGACTCCGAGACCACA
GAAGATGATATCCCATTTGTTGCTACCCGCCAGGGCGAGAGCAGTGGTGACATGGCCTGG
GAGGAGGTACGGGGTGTCTTCCGAGTGGCCATCCAGCCCGTGAATGACCACGCCCCTGTG
CAGACCATCAGCCGGATCTTCCATGTGGCCCGGGGTGGGCGGCGGCTGCTGACTACAGAC
GACGTGGCCTTCAGCGATGCTGACTCGGGCTTTGCTGACGCCCAGCTGGTGCTTACCCGC
AAGGACCTCCTCTTTGGCAGTATCGTGGCCGTAGATGAGCCCACGCGGCCCATCTACCGC
TTCACCCAGGAGGACCTCAGGAAGAGGCGAGTACTGTTCGTGCACTCAGGGGCTGACCGT
GGCTGGATCCAGCTGCAGGTGTCCGACGGGCAACACCAGGCCACTGCGCTGCTGGAGGTG
CAGGCCTCGGAACCCTACCTCCGTGTGGCCAACGGCTCCAGCCTTGTGGTCCCTCAAGGA
GGCCAGGGCACCATCGACACGGCCGTGCTCCACCTGGACACCAACCTCGACATCCGCAGT
GGGGATGAGGTCCACTACCACGTCACAGCTGGCCCTCGCTGGGGACAGCTAGTCCGGGCT
GGTCAGCCAGCCACAGCCTTCTCCCAGCAGGACCTGCTGGATGGGGCCGTTCTCTATAGC
CACAATGGCAGCCTCAGCCCCCGCGACACCATGGCCTTCTCCGTGGAAGCAGGGCCAGTG
CACACGGATGCCACCCTACAAGTGACCATTGCCCTAGAGGGCCCACTGGCCCCACTGAAG
CTGGTCCGGCACAAGAAGATCTACGTCTTCCAGGGAGAGGCAGCTGAGATCAGAAGGGAC
CAGCTGGAGGCAGCCCAGGAGGCAGTGCCACCTGCAGACATCGTATTCTCAGTGAAGAGC
CCACCGAGTGCCGGCTACCTGGTGATGGTGTCGCGTGGCGCCTTGGCAGATGAGCCACCC
AGCCTGGACCCTGTGCAGAGCTTCTCCCAGGAGGCAGTGGACACAGGCAGGGTCCTGTAC
CTGCACTCCCGCCCTGAGGCCTGGAGCGATGCCTTCTCGCTGGATGTGGCCTCAGGCCTG
GGTGCTCCCCTCGAGGGCGTCCTTGTGGAGCTGGAGGTGCTGCCCGCTGCCATCCCACTA
GAGGCGCAAAACTTCAGCGTCCCTGAGGGTGGCAGCCTCACCCTGGCCCCTCCACTGCTC
CGTGTCTCCGGGCCCTACTTCCCCACTCTCCTGGGCCTCAGCCTGCAGGTGCTGGAGCCA
CCCCAGCATGGAGCCCTGCAGAAGGAGGACGGACCTCAAGCCAGGACCCTCAGCGCCTTC
TCCTGGAGAATGGTGGAAGAGCAGCTGATCCGCTACGTGCATGACGGGAGCGAGACACTG
ACAGACAGTTTTGTCCTGATGGCTAATGCCTCCGAGATGGATCGCCAGAGCCATCCTGTG
GCCTTCACTGTCACTGTCCTGCCTGTCAATGACCAACCCCCCATCCTCACTACAAACACA
GGCCTGCAGATGTGGGAGGGGGCCACTGCGCCCATCCCTGCGGAGGCTCTGAGGAGCACG
GACGGCGACTCTGGGTCTGAGGATCTGGTCTACACCATCGAGCAGCCCAGCAACGGGCGG
GTAGTGCTGCGGGGGGCGCCGGGCACTGAGGTGCGCAGCTTCACGCAGGCCCAGCTGGAC
GGCGGGCTCGTGCTGTTCTCACACAGAGGAACCCTGGATGGAGGCTTCCGCTTCCGCCTC
TCTGACGGCGAGCACACTTCCCCCGGACACTTCTTCCGAGTGACGGCCCAGAAGCAAGTG
CTCCTCTCGCTGAAGGGCAGCCAGACACTGACTGTCTGCCCAGGGTCCGTCCAGCCACTC
AGCAGTCAGACCCTCAGGGCCAGCTCCAGCGCAGGCACTGACCCCCAGCTCCTGCTCTAC
CGTGTGGTGCGGGGCCCCCAGCTAGGCCGGCTGTTCCACGCCCAGCAGGACAGCACAGGG
GAGGCCCTGGTGAACTTCACTCAGGCAGAGGTCTACGCTGGGAATATTCTGTATGAGCAT
GAGATGCCCCCCGAGCCCTTTTGGGAGGCCCATGATACCCTAGAGCTCCAGCTGTCCTCG
CCGCCTGCCCGGGACGTGGCCGCCACCCTTGCTGTGGCTGTGTCTTTTGAGGCTGCCTGT
CCCCAGCGCCCCAGCCACCTCTGGAAGAACAAAGGTCTCTGGGTCCCCGAGGGCCAGCGG
GCCAGGATCACCGTGGCTGCTCTGGATGCCTCCAATCTCTTGGCCAGCGTTCCATCACCC
CAGCGCTCAGAGCATGATGTGCTCTTCCAGGTCACACAGTTCCCCAGCCGGGGCCAGCTG
TTGGTGTCCGAGGAGCCCCTCCATGCTGGGCAGCCCCACTTCCTGCAGTCCCAGCTGGCT
GCAGGGCAGCTAGTGTATGCCCACGGCGGTGGGGGCACCCAGCAGGATGGCTTCCACTTT
CGTGCCCACCTCCAGGGGCCAGCAGGGGCCTCCGTGGCTGGACCCCAAACCTCAGAGGCC
TTTGCCATCACGGTGAGGGATGTAAATGAGCGGCCCCCTCAGCCACAGGCCTCTGTCCCA
CTCCGGCTCACCCGAGGCTCTCGTGCCCCCATCTCCCGGGCCCAGCTGAGTGTGGTGGAC
CCAGACTCAGCTCCTGGGGAGATTGAGTACGAGGTCCAGCGGGCACCCCACAACGGCTTC
CTCAGCCTGGTGGGTGGTGGCCTGGGGCCCGTGACCCGCTTCACGCAAGCCGATGTGGAT
TCAGGGCGGCTGGCCTTCGTGGCCAACGGGAGCAGCGTGGCAGGCATCTTCCAGCTGAGC
ATGTCTGATGGGGCCAGCCCACCCCTGCCCATGTCCCTGGCTGTGGACATCCTACCATCC
GCCATCGAGGTGCAGCTGCGGGCACCCCTGGAGGTGCCCCAAGCTTTGGGGCGCTCCTCA
CTGAGCCAGCAGCAGCTCCGGGTGGTTTCAGATCGGGAGGAGCCAGAGGCAGCATACCGC
CTCATCCAGGGACCCCAGTATGGGCATCTCCTGGTGGGCGGGCGGCCCACCTCGGCCTTC
AGCCAATTCCAGATAGACCAGGGCGAGGTGGTCTTTGCCTTCACCAACTTCTCCTCCTCT
CATGACCACTTCAGAGTCCTGGCACTGGCTAGGGGTGTCAATGCATCAGCCGTAGTGAAC
GTCACTGTGAGGGCTCTGCTGCATGTGTGGGCAGGTGGGCCATGGCCCCAGGGTGCCACC
CTGCGCCTGGACCCCACCGTCCTAGATGCTGGCGAGCTGGCCAACCGCACAGGCAGTGTG
CCGCGCTTCCGCCTCCTGGAGGGACCCCGGCATGGCCGCGTGGTCCGCGTGCCCCGAGCC
AGGACGGAGCCCGGGGGCAGCCAGCTGGTGGAGCAGTTCACTCAGCAGGACCTTGAGGAC
GGGAGGCTGGGGCTGGAGGTGGGCAGGCCAGAGGGGAGGGCCCCCGGCCCCGCAGGTGAC
AGTCTCACTCTGGAGCTGTGGGCACAGGGCGTCCCGCCTGCTGTGGCCTCCCTGGACTTT
GCCACTGAGCCTTACAATGCTGCCCGGCCCTACAGCGTGGCCCTGCTCAGTGTCCCCGAG
GCCGCCCGGACGGAAGCAGGGAAGCCAGAGAGCAGCACCCCCACAGGCGAGCCAGGCCCC
ATGGCATCCAGCCCTGAGCCCGCTGTGGCCAAGGGAGGCTTCCTGAGCTTCCTTGAGGCC
AACATGTTCAGCGTCATCATCCCCATGTGCCTGGTACTTCTGCTCCTGGCGCTCATCCTG
CCCCTGCTCTTCTACCTCCGAAAACGCAACAAGACGGGCAAGCATGACGTCCAGGTCCTG
ACTGCCAAGCCCCGCAACGGCCTGGCTGGTGACACCGAGACCTTTCGCAAGGTGGAGCCA
GGCCAGGCCATCCCGCTCACAGCTGTGCCTGGCCAGGGGCCCCCTCCAGGAGGCCAGCCT
GACCCAGAGCTGCTGCAGTTCTGCCGGACACCCAACCCTGCCCTTAAGAATGGCCAGTAC
TGGGTGTGA
Protein Properties
Number of Residues 2322
Molecular Weight 250534.7
Theoretical pI 5.15
Pfam Domain Function
Signals
  • 1-29
Transmembrane Regions
  • 2225-2245
Protein Sequence
>Chondroitin sulfate proteoglycan 4
MQSGPRPPLPAPGLALALTLTMLARLASAASFFGENHLEVPVATALTDIDLQLQFSTSQP
EALLLLAAGPADHLLLQLYSGRLQVRLVLGQEELRLQTPAETLLSDSIPHTVVLTVVEGW
ATLSVDGFLNASSAVPGAPLEVPYGLFVGGTGTLGLPYLRGTSRPLRGCLHAATLNGRSL
LRPLTPDVHEGCAEEFSASDDVALGFSGPHSLAAFPAWGTQDEGTLEFTLTTQSRQAPLA
FQAGGRRGDFIYVDIFEGHLRAVVEKGQGTVLLHNSVPVADGQPHEVSVHINAHRLEISV
DQYPTHTSNRGVLSYLEPRGSLLLGGLDAEASRHLQEHRLGLTPEATNASLLGCMEDLSV
NGQRRGLREALLTRNMAAGCRLEEEEYEDDAYGHYEAFSTLAPEAWPAMELPEPCVPEPG
LPPVFANFTQLLTISPLVVAEGGTAWLEWRHVQPTLDLMEAELRKSQVLFSVTRGARHGE
LELDIPGAQARKMFTLLDVVNRKARFIHDGSEDTSDQLVLEVSVTARVPMPSCLRRGQTY
LLPIQVNPVNDPPHIIFPHGSLMVILEHTQKPLGPEVFQAYDPDSACEGLTFQVLGTSSG
LPVERRDQPGEPATEFSCRELEAGSLVYVHRGGPAQDLTFRVSDGLQASPPATLKVVAIR
PAIQIHRSTGLRLAQGSAMPILPANLSVETNAVGQDVSVLFRVTGALQFGELQKQGAGGV
EGAEWWATQAFHQRDVEQGRVRYLSTDPQHHAYDTVENLALEVQVGQEILSNLSFPVTIQ
RATVWMLRLEPLHTQNTQQETLTTAHLEATLEEAGPSPPTFHYEVVQAPRKGNLQLQGTR
LSDGQGFTQDDIQAGRVTYGATARASEAVEDTFRFRVTAPPYFSPLYTFPIHIGGDPDAP
VLTNVLLVVPEGGEGVLSADHLFVKSLNSASYLYEVMERPRHGRLAWRGTQDKTTMVTSF
TNEDLLRGRLVYQHDDSETTEDDIPFVATRQGESSGDMAWEEVRGVFRVAIQPVNDHAPV
QTISRIFHVARGGRRLLTTDDVAFSDADSGFADAQLVLTRKDLLFGSIVAVDEPTRPIYR
FTQEDLRKRRVLFVHSGADRGWIQLQVSDGQHQATALLEVQASEPYLRVANGSSLVVPQG
GQGTIDTAVLHLDTNLDIRSGDEVHYHVTAGPRWGQLVRAGQPATAFSQQDLLDGAVLYS
HNGSLSPRDTMAFSVEAGPVHTDATLQVTIALEGPLAPLKLVRHKKIYVFQGEAAEIRRD
QLEAAQEAVPPADIVFSVKSPPSAGYLVMVSRGALADEPPSLDPVQSFSQEAVDTGRVLY
LHSRPEAWSDAFSLDVASGLGAPLEGVLVELEVLPAAIPLEAQNFSVPEGGSLTLAPPLL
RVSGPYFPTLLGLSLQVLEPPQHGALQKEDGPQARTLSAFSWRMVEEQLIRYVHDGSETL
TDSFVLMANASEMDRQSHPVAFTVTVLPVNDQPPILTTNTGLQMWEGATAPIPAEALRST
DGDSGSEDLVYTIEQPSNGRVVLRGAPGTEVRSFTQAQLDGGLVLFSHRGTLDGGFRFRL
SDGEHTSPGHFFRVTAQKQVLLSLKGSQTLTVCPGSVQPLSSQTLRASSSAGTDPQLLLY
RVVRGPQLGRLFHAQQDSTGEALVNFTQAEVYAGNILYEHEMPPEPFWEAHDTLELQLSS
PPARDVAATLAVAVSFEAACPQRPSHLWKNKGLWVPEGQRARITVAALDASNLLASVPSP
QRSEHDVLFQVTQFPSRGQLLVSEEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQDGFHF
RAHLQGPAGASVAGPQTSEAFAITVRDVNERPPQPQASVPLRLTRGSRAPISRAQLSVVD
PDSAPGEIEYEVQRAPHNGFLSLVGGGLGPVTRFTQADVDSGRLAFVANGSSVAGIFQLS
MSDGASPPLPMSLAVDILPSAIEVQLRAPLEVPQALGRSSLSQQQLRVVSDREEPEAAYR
LIQGPQYGHLLVGGRPTSAFSQFQIDQGEVVFAFTNFSSSHDHFRVLALARGVNASAVVN
VTVRALLHVWAGGPWPQGATLRLDPTVLDAGELANRTGSVPRFRLLEGPRHGRVVRVPRA
RTEPGGSQLVEQFTQQDLEDGRLGLEVGRPEGRAPGPAGDSLTLELWAQGVPPAVASLDF
ATEPYNAARPYSVALLSVPEAARTEAGKPESSTPTGEPGPMASSPEPAVAKGGFLSFLEA
NMFSVIIPMCLVLLLLALILPLLFYLRKRNKTGKHDVQVLTAKPRNGLAGDTETFRKVEP
GQAIPLTAVPGQGPPPGGQPDPELLQFCRTPNPALKNGQYWV
GenBank ID Protein 47419930
UniProtKB/Swiss-Prot ID Q6UVK1
UniProtKB/Swiss-Prot Entry Name CSPG4_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001897.4
GeneCard ID CSPG4
GenAtlas ID CSPG4
HGNC ID HGNC:2466
References
General References
  1. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  2. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952 ]
  3. Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES, Nusbaum C: Analysis of the DNA sequence and duplication history of human chromosome 15. Nature. 2006 Mar 30;440(7084):671-5. [PubMed:16572171 ]
  4. Eisenmann KM, McCarthy JB, Simpson MA, Keely PJ, Guan JL, Tachibana K, Lim L, Manser E, Furcht LT, Iida J: Melanoma chondroitin sulphate proteoglycan regulates cell spreading through Cdc42, Ack-1 and p130cas. Nat Cell Biol. 1999 Dec;1(8):507-13. [PubMed:10587647 ]
  5. Iida J, Pei D, Kang T, Simpson MA, Herlyn M, Furcht LT, McCarthy JB: Melanoma chondroitin sulfate proteoglycan regulates matrix metalloproteinase-dependent human melanoma invasion into type I collagen. J Biol Chem. 2001 Jun 1;276(22):18786-94. Epub 2001 Mar 6. [PubMed:11278606 ]
  6. Pluschke G, Vanek M, Evans A, Dittmar T, Schmid P, Itin P, Filardo EJ, Reisfeld RA: Molecular cloning of a human melanoma-associated chondroitin sulfate proteoglycan. Proc Natl Acad Sci U S A. 1996 Sep 3;93(18):9710-5. [PubMed:8790396 ]
  7. Yang J, Price MA, Neudauer CL, Wilson C, Ferrone S, Xia H, Iida J, Simpson MA, McCarthy JB: Melanoma chondroitin sulfate proteoglycan enhances FAK and ERK activation by distinct mechanisms. J Cell Biol. 2004 Jun 21;165(6):881-91. [PubMed:15210734 ]
  8. Iida J, Meijne AM, Oegema TR Jr, Yednock TA, Kovach NL, Furcht LT, McCarthy JB: A role of chondroitin sulfate glycosaminoglycan binding site in alpha4beta1 integrin-mediated melanoma cell adhesion. J Biol Chem. 1998 Mar 6;273(10):5955-62. [PubMed:9488735 ]
  9. Staub E, Hinzmann B, Rosenthal A: A novel repeat in the melanoma-associated chondroitin sulfate proteoglycan defines a new protein family. FEBS Lett. 2002 Sep 11;527(1-3):114-8. [PubMed:12220645 ]
  10. Fukushi J, Makagiansar IT, Stallcup WB: NG2 proteoglycan promotes endothelial cell motility and angiogenesis via engagement of galectin-3 and alpha3beta1 integrin. Mol Biol Cell. 2004 Aug;15(8):3580-90. Epub 2004 Jun 4. [PubMed:15181153 ]