You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10850
Secondary Accession Numbers
  • 17140
Name Potassium voltage-gated channel subfamily C member 4
Synonyms
  1. KSHIIIC
  2. Voltage-gated potassium channel subunit Kv3.4
Gene Name KCNC4
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function This protein mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
ion channel complex
cation channel complex
potassium channel complex
voltage-gated potassium channel complex
macromolecular complex
intrinsic to membrane
protein complex
integral to membrane
Function
binding
protein binding
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
potassium channel activity
voltage-gated potassium channel activity
Process
establishment of localization
transport
transmembrane transport
monovalent inorganic cation transport
potassium ion transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 1p21
SNPs KCNC4
Gene Sequence
>1908 bp
ATGATCAGCTCGGTGTGTGTCTCCTCCTACCGCGGGCGCAAGTCGGGGAACAAGCCTCCG
TCCAAAACATGTCTGAAGGAGGAGATGGCCAAGGGCGAGGCGTCGGAGAAGATCATCATC
AACGTGGGCGGCACGCGACATGAGACCTACCGCAGCACCCTGCGCACCCTACCGGGAACC
CGCCTCGCCTGGCTGGCCGACCCCGACGGCGGGGGCCGGCCCGAGACCGATGGCGGCGGT
GTGGGTAGCAGCGGCAGCAGCGGCGGCGGGGGCTGCGAGTTCTTCTTCGACAGGCACCCG
GGCGTCTTCGCCTACGTGCTCAACTACTACCGCACCGGCAAGCTGCACTGCCCCGCGGAC
GTGTGCGGGCCGCTCTTCGAAGAGGAGCTCACCTTCTGGGGCATCGACGAGACCGACGTG
GAACCCTGCTGCTGGATGACCTACCGGCAGCACCGCGACGCCGAGGAGGCGCTCGACATC
TTCGAGAGCCCGGACGGAGGCGGCAGCGGCGCGGGGCCCAGCGACGAGGCCGGCGACGAT
GAGCGGGAGCTGGCCCTGCAGCGACTGGGCCCCCACGAGGGAGGCGCGGGCCATGGCGCC
GGGTCTGGGGGCTGCCGCGGCTGGCAGCCCCGCATGTGGGCGCTCTTCGAGGATCCCTAC
TCCTCCCGGGCCGCTAGGGTAGTGGCCTTTGCCTCTCTCTTCTTCATCCTGGTCTCCATC
ACCACTTTCTGCCTGGAGACCCATGAGGCCTTTAATATCGACCGCAACGTGACAGAGATC
CTCCGCGTAGGGAACATCACCAGCGTGCACTTCCGGCGGGAGGTAGAGACAGAGCCCATC
CTGACCTACATCGAGGGCGTATGTGTGCTGTGGTTCACACTGGAGTTCCTGGTGCGCATC
GTGTGCTGCCCCGACACGCTGGACTTCGTCAAGAACCTGCTCAACATCATCGACTTTGTG
GCCATCCTGCCCTTCTACCTGGAGGTGGGGCTGAGCGGCCTGTCATCCAAGGCGGCCCGC
GACGTGCTGGGCTTCCTGCGCGTGGTGCGCTTCGTGCGCATCCTGCGTATCTTCAAGCTC
ACACGCCACTTCGTGGGGCTACGCGTGCTGGGCCACACCCTGAGGGCCAGCACCAATGAG
TTCCTGCTGCTTATCATCTTCCTGGCCCTGGGTGTGCTCATCTTTGCCACCATGATCTAC
TACGCTGAGCGCATTGGGGCCAGGCCCTCCGACCCTCGGGGTAATGACCACACCGACTTC
AAGAACATCCCCATTGGCTTCTGGTGGGCTGTGGTCACCATGACGACACTGGGCTACGGA
GACATGTACCCCAAGACGTGGTCAGGCATGCTGGTAGGGGCACTGTGTGCACTGGCTGGC
GTGCTCACCATCGCCATGCCGGTGCCTGTCATCGTCAACAACTTCGGCATGTACTACTCC
CTGGCCATGGCCAAGCAGAAGCTGCCCAAGAAACGGAAGAAGCACGTGCCACGGCCGGCG
CAGCTGGAGTCACCCATGTACTGCAAGTCTGAGGAGACTTCCCCCCGGGACAGCACCTGC
AGTGATACCAGCCCCCCTGCCCGGGAAGAGGGTATGATCGAGAGGAAACGGGCAGACTCT
AAGCAGAATGGCGATGCCAACGCAGTGCTGTCTGATGAGGAGGGAGCTGGCCTCACCCAA
CCCCTGGCCTCCTCCCCGACCCCCGAGGAGCGCCGGGCCCTGCGACGCTCCACCACTCGA
GACAGAAACAAGAAGGCAGCTGCCTGCTTCCTGCTCAGCACTGGGGACTATGCCTGCGCC
GATGGTAGTGTCCGGAAAGGCACATTCGTCCTCCGTGACCTTCCCCTTCAGCATTCACCT
GAGGCTGCATGCCCTCCAACTGCTGGGACTCTGTTCCTGCCACATTGA
Protein Properties
Number of Residues 635
Molecular Weight 69766.1
Theoretical pI 6.98
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 227-247
  • 278-298
  • 313-333
  • 345-364
  • 381-401
  • 452-472
Protein Sequence
>Potassium voltage-gated channel subfamily C member 4
MISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASEKIIINVGGTRHETYRSTLRTLPGT
RLAWLADPDGGGRPETDGGGVGSSGSSGGGGCEFFFDRHPGVFAYVLNYYRTGKLHCPAD
VCGPLFEEELTFWGIDETDVEPCCWMTYRQHRDAEEALDIFESPDGGGSGAGPSDEAGDD
ERELALQRLGPHEGGAGHGAGSGGCRGWQPRMWALFEDPYSSRAARVVAFASLFFILVSI
TTFCLETHEAFNIDRNVTEILRVGNITSVHFRREVETEPILTYIEGVCVLWFTLEFLVRI
VCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRILRIFKL
TRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTDF
KNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYS
LAMAKQKLPKKRKKHVPRPAQLESPMYCKSEETSPRDSTCSDTSPPAREEGMIERKRADS
KQNGDANAVLSDEEGAGLTQPLASSPTPEERRALRRSTTRDRNKKAAACFLLSTGDYACA
DGSVRKGTFVLRDLPLQHSPEAACPPTAGTLFLPH
GenBank ID Protein 56204186
UniProtKB/Swiss-Prot ID Q03721
UniProtKB/Swiss-Prot Entry Name KCNC4_HUMAN
PDB IDs Not Available
GenBank Gene ID AL137790
GeneCard ID KCNC4
GenAtlas ID KCNC4
HGNC ID HGNC:6236
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Antz C, Geyer M, Fakler B, Schott MK, Guy HR, Frank R, Ruppersberg JP, Kalbitzer HR: NMR structure of inactivation gates from mammalian voltage-dependent potassium channels. Nature. 1997 Jan 16;385(6613):272-5. [PubMed:9000078 ]
  4. Vega-Saenz de Miera E, Moreno H, Fruhling D, Kentros C, Rudy B: Cloning of ShIII (Shaw-like) cDNAs encoding a novel high-voltage-activating, TEA-sensitive, type-A K+ channel. Proc Biol Sci. 1992 Apr 22;248(1321):9-18. [PubMed:1381835 ]
  5. Covarrubias M, Wei A, Salkoff L, Vyas TB: Elimination of rapid potassium channel inactivation by phosphorylation of the inactivation gate. Neuron. 1994 Dec;13(6):1403-12. [PubMed:7993631 ]
  6. Beck EJ, Sorensen RG, Slater SJ, Covarrubias M: Interactions between multiple phosphorylation sites in the inactivation particle of a K+ channel. Insights into the molecular mechanism of protein kinase C action. J Gen Physiol. 1998 Jul;112(1):71-84. [PubMed:9649584 ]
  7. Antz C, Bauer T, Kalbacher H, Frank R, Covarrubias M, Kalbitzer HR, Ruppersberg JP, Baukrowitz T, Fakler B: Control of K+ channel gating by protein phosphorylation: structural switches of the inactivation gate. Nat Struct Biol. 1999 Feb;6(2):146-50. [PubMed:10048926 ]