You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10919
Secondary Accession Numbers
  • 17220
Name Zinc finger protein 43
Synonyms
  1. Zinc finger protein 39
  2. Zinc finger protein HTF6
  3. Zinc finger protein KOX27
Gene Name ZNF43
Protein Type Unknown
Biological Properties
General Function Involved in zinc ion binding
Specific Function May be involved in transcriptional regulation
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
nucleic acid binding
Process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
regulation of transcription, dna-dependent
Cellular Location
  1. Nucleus (Probable)
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13.1-p12
SNPs ZNF43
Gene Sequence
>2430 bp
ATGGGACCATTGACATTTATGGATGTGGCCATAGAATTCTGTCTGGAGGAGTGGCAATGC
CTGGACATTGCACAGCAGAATTTATATAGGAATGTGATGTTAGAGAACTACAGAAACCTG
GTCTTCCTGGGTATTGCTGTCTCTAAGCCAGACCTGATCACCTGTCTGGAGCAAGAAAAA
GAGCCTTGGGAGCCTATGAGGAGACATGAAATGGTAGCCAAACCCCCAGTTATGTGTTCT
CATTTTACCCAAGACTTTTGGCCAGAGCAGCATATAAAAGATCCTTTCCAAAAAGCGACA
CTGAGAAGATATAAAAACTGTGAACATAAAAATGTACATTTAAAAAAAGACCATAAAAGT
GTGGATGAGTGTAAGGTGCACAGAGGAGGTTATAATGGATTTAACCAATGTTTGCCAGCT
ACCCAGAGCAAAATATTTCTATTTGATAAATGTGTGAAAGCCTTTCATAAATTTTCAAAT
TCAAACAGACATAAGATAAGCCATACTGAAAAAAAACTTTTCAAATGCAAAGAATGTGGC
AAATCATTTTGCATGCTTCCACATCTAGCTCAACATAAAATAATTCATACCAGAGTGAAT
TTCTGCAAATGTGAAAAATGTGGAAAAGCTTTTAACTGCCCTTCAATCATCACTAAACAT
AAGAGAATTAATACTGGAGAGAAACCCTACACATGTGAAGAATGTGGCAAAGTCTTTAAT
TGGTCCTCACGCCTTACTACACATAAAAAAAATTATACTAGATACAAACTCTACAAATGT
GAAGAATGTGGCAAAGCTTTTAACAAGTCCTCAATCCTTACTACCCATAAGATAATTCGC
ACTGGAGAGAAATTCTACAAATGTAAAGAATGTGCCAAAGCTTTTAACCAATCCTCAAAC
CTTACTGAACATAAGAAAATTCATCCTGGAGAGAAACCTTACAAATGTGAAGAATGTGGC
AAAGCCTTTAACTGGCCCTCAACTCTTACTAAACATAAGAGAATTCATACTGGAGAGAAA
CCCTACACATGTGAAGAATGTGGCAAAGCCTTTAACCAGTTCTCAAACCTTACTACACAT
AAGAGAATCCATACTGCAGAGAAATTCTATAAATGTACAGAATGTGGTGAAGCTTTTAGC
CGGTCCTCAAACCTTACTAAACATAAGAAAATTCATACTGAAAAGAAACCCTACAAATGT
GAAGAATGTGGCAAAGCTTTTAAGTGGTCCTCAAAGCTTACTGAACATAAGTTAACTCAT
ACTGGAGAGAAACCCTACAAATGTGAAGAATGTGGCAAAGCCTTTAACTGGCCCTCAACC
CTTACTAAACATAACAGAATTCATACTGGAGAGAAACCCTACAAATGTGAAGTATGTGGC
AAAGCCTTTAACCAGTTCTCAAACCTTACTACACATAAGAGAATTCATACTGCAGAAAAA
CCGTACAAATGTGAAGAATGTGGCAAAGCTTTTAGCCGGTCCTCAAACCTTACTAAACAT
AAGAAAATTCACATTGAAAAGAAACCCTACAAATGTGAAGAATGTGGCAAAGCTTTTAAG
TGGTCCTCAAAGCTTACTGAACATAAGATAACTCATACTGGAGAGAAACCCTACAAATGT
GAAGAATGTGGCAAAGCTTTTAACCATTTCTCAATCCTTACCAAACATAAGAGGATTCAT
ACTGGAGAGAAACCCTACAAGTGTGAAGAATGTGGCAAAGCTTTTACCCAATCCTCAAAC
CTTACTACACATAAGAAAATTCATACTGGAGAGAAATTCTACAAATGTGAAGAATGTGGC
AAAGCTTTTACCCAATCTTCAAACCTTACTACACATAAAAAAATTCATACTGGAGGAAAA
CCCTACAAATGTGAAGAATGTGGCAAAGCTTTTAACCAGTTCTCAACTCTTACTAAACAT
AAGATAATTCACACTGAGGAGAAACCCTACAAATGTGAAGAATGTGGCAAAGCCTTTAAG
TGGTCCTCAACCCTTACTAAACATAAGATAATTCATACTGGAGAGAAACCCTACAAATGT
GAAGAATGTGGCAAAGCTTTTAAACTGTCCTCAACCCTTTCTACACATAAGATTATTCAT
ACTGGAGAGAAACCCTACAAATGTGAAAAATGTGGCAAAGCTTTTAACCGATCCTCAAAC
CTTATTGAACATAAGAAAATTCATACTGGAGAGCAACCCTACAAATGTGAAGAATGTGGC
AAAGCATTTAACTATTCCTCACACCTTAATACACATAAGAGAATTCATACTAAAGAGCAA
CCCTACAAATGTAAAGAATGTGGCAAAGCTTTCAACCAATATTCAAACCTTACTACACAT
AACAAAATTCATACTGGAGAGAAACTCTACAAACCTGAAGATGTGACAGTGATTTTGACA
ACACCTCAAACTTTTTCAAACATAAAATAA
Protein Properties
Number of Residues 809
Molecular Weight 94124.0
Theoretical pI 9.64
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Zinc finger protein 43
MGPLTFMDVAIEFCLEEWQCLDIAQQNLYRNVMLENYRNLVFLGIAVSKPDLITCLEQEK
EPWEPMRRHEMVAKPPVMCSHFTQDFWPEQHIKDPFQKATLRRYKNCEHKNVHLKKDHKS
VDECKVHRGGYNGFNQCLPATQSKIFLFDKCVKAFHKFSNSNRHKISHTEKKLFKCKECG
KSFCMLPHLAQHKIIHTRVNFCKCEKCGKAFNCPSIITKHKRINTGEKPYTCEECGKVFN
WSSRLTTHKKNYTRYKLYKCEECGKAFNKSSILTTHKIIRTGEKFYKCKECAKAFNQSSN
LTEHKKIHPGEKPYKCEECGKAFNWPSTLTKHKRIHTGEKPYTCEECGKAFNQFSNLTTH
KRIHTAEKFYKCTECGEAFSRSSNLTKHKKIHTEKKPYKCEECGKAFKWSSKLTEHKLTH
TGEKPYKCEECGKAFNWPSTLTKHNRIHTGEKPYKCEVCGKAFNQFSNLTTHKRIHTAEK
PYKCEECGKAFSRSSNLTKHKKIHIEKKPYKCEECGKAFKWSSKLTEHKITHTGEKPYKC
EECGKAFNHFSILTKHKRIHTGEKPYKCEECGKAFTQSSNLTTHKKIHTGEKFYKCEECG
KAFTQSSNLTTHKKIHTGGKPYKCEECGKAFNQFSTLTKHKIIHTEEKPYKCEECGKAFK
WSSTLTKHKIIHTGEKPYKCEECGKAFKLSSTLSTHKIIHTGEKPYKCEKCGKAFNRSSN
LIEHKKIHTGEQPYKCEECGKAFNYSSHLNTHKRIHTKEQPYKCKECGKAFNQYSNLTTH
NKIHTGEKLYKPEDVTVILTTPQTFSNIK
GenBank ID Protein 68303809
UniProtKB/Swiss-Prot ID P17038
UniProtKB/Swiss-Prot Entry Name ZNF43_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_003423.2
GeneCard ID ZNF43
GenAtlas ID ZNF43
HGNC ID HGNC:13109
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  5. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  6. Thiesen HJ: Multiple genes encoding zinc finger domains are expressed in human T cells. New Biol. 1990 Apr;2(4):363-74. [PubMed:2288909 ]
  7. Lovering R, Trowsdale J: A gene encoding 22 highly related zinc fingers is expressed in lymphoid cell lines. Nucleic Acids Res. 1991 Jun 11;19(11):2921-8. [PubMed:1711675 ]
  8. Bellefroid EJ, Poncelet DA, Lecocq PJ, Revelant O, Martial JA: The evolutionarily conserved Kruppel-associated box domain defines a subfamily of eukaryotic multifingered proteins. Proc Natl Acad Sci U S A. 1991 May 1;88(9):3608-12. [PubMed:2023909 ]