You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10940
Secondary Accession Numbers
  • 17253
Name Protein kinase C, gamma variant
Synonyms Not Available
Gene Name Not Available
Protein Type Enzyme
Biological Properties
General Function Involved in intracellular signaling pathway
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Process
intracellular signaling pathway
signaling
signaling pathway
Cellular Location Not Available
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs Not Available
Gene Sequence
>720 bp
GATCCTGGTCCCTGCTACGTTTCTGGGGCCATGGCTGGTCTGGGCCCCGGCGTAGGCGAT
TCAGAGGGGGGACCCCGGCCCCTGTTTTGCAGAAAGGGGGCTCTGAGGCAGAAGGTGGTC
CACGAAGTCAAGAGCCACAAGTTCACCGCTCGCTTCTTCAAGCAGCCCACCTTCTGCAGC
CACTGCACCGACTTCATCTGGGGTATCGGAAAGCAGGGCCTGCAATGTCAAGTCTGCAGC
TTTGTGGTTCATCGACGATGCCACGAATTTGTGACCTTCGAGTGTCCAGGCGCTGGGAAG
GGCCCCCAGACGGACGACCCCCGGAACAAACACAAGTTCCGCCTGCATAGCTACAGCAGC
CCCACCTTCTGCGACCACTGTGGCTCCCTCCTCTACGGGCTTGTGCACCAGGGCATGAAA
TGCTCCTGCTGCGAGATGAACGTGCACCGGCGCTGTGTGCGTAGCGTGCCCTCCCTGTGC
GGTGTGGACCACACCGAGCGCCGCGGGCGCCTGCAGCTGGAGATCCGGGCTCCCACAGCA
GATGAGATCCACGTAACTGTTGGCGAGGCCCGTAACCTAATTCCTATGGACCCCAATGGT
CTCTCTGATCCCTATGTGAAACTGAAGCTCATCCCAGACCCTCGGAACCTGACGAAACAG
AAGACCCGAACGGTGAAAGCCACGCTAAACCCTGTGTGGAATGAGACCTTTGTGTTGTGA
Protein Properties
Number of Residues 239
Molecular Weight 26658.6
Theoretical pI 8.93
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Protein kinase C, gamma variant
DPGPCYVSGAMAGLGPGVGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCS
HCTDFIWGIGKQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSS
PTFCDHCGSLLYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTA
DEIHVTVGEARNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVL
GenBank ID Protein 62088922
UniProtKB/Swiss-Prot ID Q59EZ0
UniProtKB/Swiss-Prot Entry Name Q59EZ0_HUMAN
PDB IDs
GenBank Gene ID AB209671
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:9402
References
General References Not Available