Hmdb loader
Identification
HMDB Protein ID HMDBP10985
Secondary Accession Numbers
  • 17303
Name Apolipoprotein C-II
Synonyms
  1. Apo-CII
  2. ApoC-II
  3. Apolipoprotein C2
Gene Name APOC2
Protein Type Unknown
Biological Properties
General Function Involved in enzyme activator activity
Specific Function Component of the very low density lipoprotein (VLDL) fraction in plasma, and is an activator of several triacylglycerol lipases. The association of APOC2 with plasma chylomicrons, VLDL, and HDL is reversible, a function of the secretion and catabolism of triglyceride-rich lipoproteins, and changes rapidly
Pathways Not Available
Reactions Not Available
GO Classification
Component
macromolecular complex
chylomicron
protein-lipid complex
plasma lipoprotein particle
Function
enzyme regulator activity
enzyme activator activity
Process
metabolic process
primary metabolic process
establishment of localization
transport
lipid metabolic process
lipid transport
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:1
Locus 19q13.2
SNPs APOC2
Gene Sequence
>306 bp
ATGGGCACACGACTCCTCCCAGCTCTGTTTCTTGTCCTCCTGGTATTGGGATTTGAGGTC
CAGGGGACCCAACAGCCCCAGCAAGATGAGATGCCTAGCCCGACCTTCCTCACCCAGGTG
AAGGAATCTCTCTCCAGTTACTGGGAGTCAGCAAAGACAGCCGCCCAGAACCTGTACGAG
AAGACATACCTGCCCGCTGTAGATGAGAAACTCAGGGACTTGTACAGCAAAAGCACAGCA
GCCATGAGCACTTACACAGGCATTTTTACTGACCAAGTTCTTTCTGTGCTGAAGGGAGAG
GAGTAA
Protein Properties
Number of Residues 101
Molecular Weight 11283.8
Theoretical pI 4.36
Pfam Domain Function
Signals
  • 1-22
Transmembrane Regions
  • None
Protein Sequence
>Apolipoprotein C-II
MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYE
KTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE
GenBank ID Protein 32130518
UniProtKB/Swiss-Prot ID P02655
UniProtKB/Swiss-Prot Entry Name APOC2_HUMAN
PDB IDs
GenBank Gene ID NM_000483.3
GeneCard ID APOC2
GenAtlas ID APOC2
HGNC ID HGNC:609
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Halushka MK, Fan JB, Bentley K, Hsie L, Shen N, Weder A, Cooper R, Lipshutz R, Chakravarti A: Patterns of single-nucleotide polymorphisms in candidate genes for blood-pressure homeostasis. Nat Genet. 1999 Jul;22(3):239-47. [PubMed:10391210 ]
  3. Sharpe CR, Sidoli A, Shelley CS, Lucero MA, Shoulders CC, Baralle FE: Human apolipoproteins AI, AII, CII and CIII. cDNA sequences and mRNA abundance. Nucleic Acids Res. 1984 May 11;12(9):3917-32. [PubMed:6328445 ]
  4. Fojo SS, Law SW, Brewer HB Jr: The human preproapolipoprotein C-II gene. Complete nucleic acid sequence and genomic organization. FEBS Lett. 1987 Mar 9;213(1):221-6. [PubMed:3030808 ]
  5. Fojo SS, Law SW, Brewer HB Jr: Human apolipoprotein C-II: complete nucleic acid sequence of preapolipoprotein C-II. Proc Natl Acad Sci U S A. 1984 Oct;81(20):6354-7. [PubMed:6593704 ]
  6. Das HK, Jackson CL, Miller DA, Leff T, Breslow JL: The human apolipoprotein C-II gene sequence contains a novel chromosome 19-specific minisatellite in its third intron. J Biol Chem. 1987 Apr 5;262(10):4787-93. [PubMed:3558370 ]
  7. Wei CF, Tsao YK, Robberson DL, Gotto AM Jr, Brown K, Chan L: The structure of the human apolipoprotein C-II gene. Electron microscopic analysis of RNA:DNA hybrids, complete nucleotide sequence, and identification of 5' homologous sequences among apolipoprotein genes. J Biol Chem. 1985 Dec 5;260(28):15211-21. [PubMed:2415514 ]
  8. Myklebost O, Williamson B, Markham AF, Myklebost SR, Rogers J, Woods DE, Humphries SE: The isolation and characterization of cDNA clones for human apolipoprotein CII. J Biol Chem. 1984 Apr 10;259(7):4401-4. [PubMed:6546757 ]
  9. Jackson CL, Bruns GA, Breslow JL: Isolation of cDNA and genomic clones for apolipoprotein C-II. Methods Enzymol. 1986;128:788-800. [PubMed:3014272 ]
  10. Hospattankar AV, Fairwell T, Ronan R, Brewer HB Jr: Amino acid sequence of human plasma apolipoprotein C-II from normal and hyperlipoproteinemic subjects. J Biol Chem. 1984 Jan 10;259(1):318-22. [PubMed:6706938 ]
  11. Jackson RL, Baker HN, Gilliam EB, Gotto AM Jr: Primary structure of very low density apolipoprotein C-II of human plasma. Proc Natl Acad Sci U S A. 1977 May;74(5):1942-5. [PubMed:194244 ]
  12. Chun EM, Park YJ, Kang HS, Cho HM, Jun DY, Kim YH: Expression of the apolipoprotein C-II gene during myelomonocytic differentiation of human leukemic cells. J Leukoc Biol. 2001 Apr;69(4):645-50. [PubMed:11310852 ]
  13. Lycksell PO, Ohman A, Bengtsson-Olivecrona G, Johansson LB, Wijmenga SS, Wernic D, Graslund A: Sequence specific 1H-NMR assignments and secondary structure of a carboxy-terminal functional fragment of apolipoprotein CII. Eur J Biochem. 1992 Apr 1;205(1):223-31. [PubMed:1555583 ]
  14. Ohman A, Lycksell PO, Graslund A: A refined three-dimensional solution structure of a carboxy terminal fragment of apolipoprotein CII. Eur Biophys J. 1993;22(5):351-7. [PubMed:8112221 ]
  15. Menzel HJ, Kane JP, Malloy MJ, Havel RJ: A variant primary structure of apolipoprotein C-II in individuals of African descent. J Clin Invest. 1986 Feb;77(2):595-601. [PubMed:3944271 ]
  16. Pullinger CR, Zysow BR, Hennessy LK, Frost PH, Malloy MJ, Kane JP: Molecular cloning and characteristics of a new apolipoprotein C-II mutant identified in three unrelated individuals with hypercholesterolemia and hypertriglyceridemia. Hum Mol Genet. 1993 Jan;2(1):69-74. [PubMed:8490626 ]
  17. Hegele RA, Connelly PW, Maguire GF, Huff MW, Leiter L, Wolfe BM, Evans AJ, Little JA: An apolipoprotein CII mutation, CIILys19----Thr' identified in patients with hyperlipidemia. Dis Markers. 1991 Mar-Apr;9(2):73-80. [PubMed:1782747 ]
  18. Zysow BR, Pullinger CR, Hennessy LK, Farese RV Jr, Ghassemzadeh M, Kane JP: The apolipoprotein C-II variant apoC-IILys19-->Thr is not associated with dyslipidemia in an affected kindred. Clin Genet. 1994 Jun;45(6):292-7. [PubMed:7923858 ]
  19. Inadera H, Hibino A, Kobayashi J, Kanzaki T, Shirai K, Yukawa S, Saito Y, Yoshida S: A missense mutation (Trp 26-->Arg) in exon 3 of the apolipoprotein CII gene in a patient with apolipoprotein CII deficiency (apo CII-Wakayama). Biochem Biophys Res Commun. 1993 Jun 30;193(3):1174-83. [PubMed:8323539 ]