You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11489
Secondary Accession Numbers
  • 17840
Name Rho guanine nucleotide exchange factor 10-like protein
Synonyms
  1. GrinchGEF
Gene Name ARHGEF10L
Protein Type Unknown
Biological Properties
General Function Involved in Rho guanyl-nucleotide exchange factor activity
Specific Function Acts as guanine nucleotide exchange factor (GEF) for RHOA, RHOB and RHOC
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
small gtpase regulator activity
ras guanyl-nucleotide exchange factor activity
rho guanyl-nucleotide exchange factor activity
enzyme regulator activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
Process
regulation of ras protein signal transduction
regulation of rho protein signal transduction
biological regulation
regulation of biological process
regulation of cellular process
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 1p36.13
SNPs ARHGEF10L
Gene Sequence
>3840 bp
ATGGCTTCCTCCAACCCTCCTCCACAGCCTGCCATAGGAGATCAGCTGGTTCCAGGAGTC
CCAGGCCCCTCCTCTGAGGCAGAGGACGACCCAGGAGAGGCGTTTGAGTTTGATGACAGT
GATGATGAAGAGGACACCAGCGCAGCCCTGGGCGTCCCCAGCCTTGCTCCTGAGAGGGAC
ACAGACCCCCCACTGATCCACTTGGACTCCATCCCTGTCACTGACCCAGACCCAGCAGCT
GCTCCACCCGGCACAGGGGTGCCAGCCTGGGTGAGCAATGGGGATGCAGCGGACGCAGCC
TTCTCCGGGGCCCGGCACTCCAGCTGGAAGCGGAAGAGTTCCCGTCGCATTGACCGGTTC
ACTTTCCCCGCCCTGGAAGAGGATGTGATTTATGACGACGTCCCCTGCGAGAGCCCAGAT
GCGCATCAGCCCGGGGCAGAGAGGAACCTGCTCTACGAGGATGCGCACCGGGCTGGGGCC
CCTCGGCAGGCGGAGGACCTAGGCTGGAGCTCCAGTGAGTTCGAGAGCTACAGCGAGGAC
TCGGGGGAGGAGGCCAAGCCGGAGGTCGAGGTCGAGCCCGCCAAGCACCGAGTGTCCTTC
CAGCCCAAGCTTTCTCCAGACCTGACTAGGCTAAAGGAGAGATACGCCAGGACTAAGAGA
GACATCTTGGCTTTGAGAGTTGGGGGGAGAGACATGCAGGAGCTGAAGCACAAGTACGAT
TGTAAGATGACCCAGCTCATGAAGGCCGCCAAGAGCGGGACCAAGGATGGGCTGGAGAAG
ACACGGATGGCCGTGATGCGCAAAGTCTCCTTCCTGCACAGGAAGGACGTCCTCGGTGAC
TCGGAGGAGGAGGACATGGGGCTCCTGGAGGTCAGCGTTTCGGACATCAAGCCCCCAGCC
CCAGAGCTGGGCCCCATGCCAGAGGGCCTGAGCCCTCAGCAGGTGGTCCGGAGGCATATC
CTGGGCTCCATCGTGCAGAGCGAAGGCAGCTACGTGGAGTCTCTGAAGCGGATACTCCAG
GACTACCGCAACCCCCTGATGGAGATGGAGCCCAAGGCGCTGAGCGCCCGCAAGTGCCAG
GTGGTGTTCTTCCGCGTGAAGGAGATCCTGCACTGCCACTCCATGTTCCAGATCGCCCTG
TCCTCCCGCGTGGCTGAGTGGGATTCCACCGAGAAGATCGGGGACCTCTTCGTGGCCTCG
TTTTCCAAGTCCATGGTGCTAGATGTGTACAGTGACTACGTGAACAACTTCACCAGTGCC
ATGTCCATCATCAAGAAGGCCTGCCTCACCAAGCCTGCCTTCCTCGAGTTCCTCAAGCGA
CGGCAGGTGTGCAGCCCAGACCGTGTCACCCTCTACGGGCTGATGGTCAAGCCCATCCAG
AGGTTCCCACAGTTCATACTCCTGCTTCAGGACATGCTGAAGAACACCCCCAGGGGCCAT
CCGGACAGGCTGTCGCTGCAGCTGGCCCTCACAGAGCTGGAGACGCTGGCTGAGAAGCTG
AACGAGCAGAAGCGGCTGGCTGACCAGGTGGCTGAGATCCAGCAGCTGACCAAGAGCGTC
AGTGACCGCAGCAGCCTCAACAAGCTGTTGACCTCAGGCCAGCGGCAGCTGCTCCTGTGT
GAGACGTTGACGGAGACCGTGTACGGTGACCGCGGGCAGCTAATTAAGTCCAAGGAGCGT
CGGGTCTTCCTGCTCAACGACATGCTTGTCTGTGCCAACATCAACTTCAAGCCTGCCAAC
CACAGGGGCCAGCTGGAGATCAGCAGCCTGGTGCCCCTGGGGCCCAAGTATGTGGTGAAG
TGGAACACGGCGCTGCCCCAGGTGCAGGTGGTGGAGGTGGGCCAGGACGGTGGCACCTAT
GACAAGGACAATGTGCTCATCCAGCACTCAGGCGCCAAGAAGGCCTCTGCCTCAGGGCAG
GCTCAGAATAAGGTGTACCTCGGCCCCCCACGCCTCTTCCAGGAGCTGCAGGACCTGCAG
AAGGACCTGGCCGTGGTGGAGCAGATCACGCTTCTCATCAGCACGCTGCACGGCACCTAC
CAGAACCTGAACATGACTGTGGCTCAAGACTGGTGCCTGGCCCTGCAGAGGCTGATGCGG
GTGAAGGAGGAAGAGATCCACTCGGCCAACAAGTGCCGTCTCAGGCTCCTGCTTCCTGGG
AAACCCGACAAGTCCGGCCGCCCCATTAGCTTCATGGTGGTTTTCATCACCCCCAACCCC
CTGAGCAAGATTTCCTGGGTCAACAGGTTACATTTGGCCAAAATCGGACTCCGGGAGGAG
AACCAGCCAGGCTGGCTATGCCCGGATGAGGACAAGAAGAGCAAAGCCCCATTCTGGTGC
CCGATCCTGGCCTGCTGCATCCCTGCCTTCTCCTCCCGGGCACTCAGCCTGCAGCTTGGG
GCCCTGGTCCACAGTCCTGTCAACTGTCCCCTGCTGGGTTTCTCAGCAGTCAGCACCTCC
CTTCCACAGGGCTACCTCTGGGTCGGGGGCGGACAGGAAGGCGCAGGGGGCCAGGTGGAA
ATCTTTTCCTTGAACCGGCCCTCGCCCCGCACCGTCAAGTCCTTCCCACTGGCAGCCCCT
GTGCTCTGCATGGAGTATATCCCGGAGCTGGAGGAGGAGGCGGAGAGCAGAGACGAGAGC
CCGACAGTTGCTGACCCCTCGGCCACGGTGCATCCAACCATCTGCCTCGGGCTCCAGGAT
GGCAGCATCCTCCTCTACAGCAGTGTGGACACTGGCACCCAGTGCCTGGTGAGCTGCAGG
AGCCCAGGTCTGCAGCCTGTGCTCTGCCTGCGACACAGCCCCTTCCACCTGCTCGCTGGC
CTGCAGGATGGGACCCTTGCTGCTTACCCTCGGACCAGCGGAGGTGTCCTGTGGGACCTG
GAGAGCCCTCCCGTGTGCCTGACTGTGGGGCCCGGGCCTGTCCGCACCCTGTTGAGCCTG
GAGGATGCCGTGTGGGCCAGCTGTGGGCCCCGGGTCACTGTCCTGGAAGCCACCACCCTG
CAGCCTCAGCAAAGCTTCGAGGCGCACCAGGACGAGGCAGTGAGCGTGACACACATGGTG
AAGGCGGGCAGCGGCGTCTGGATGGCCTTCTCCTCCGGCACCTCCATCCGCCTCTTCCAC
ACTGAGACCCTGGAGCATCTGCAAGAGATCAACATCGCCACCAGGACCACCTTCCTCCTG
CCAGGCCAGAAGCACTTGTGTGTCACCAGCCTCCTGATCTGCCAGGGTCTGCTCTGGGTG
GGCACTGACCAGGGTGTCATCGTCCTGCTGCCCGTGCCTCGGCTGGAAGGCATCCCCAAG
ATCACAGGGAAAGGCATGGTCTCACTCAACGGGCACTGTGGGCCTGTGGCCTTCCTGGCT
GTGGCTACCAGCATCCTGGCCCCTGACATCCTGCGGAGTGACCAGGAGGAGGCTGAGGGG
CCCCGGGCTGAGGAGGACAAGCCAGACGGGCAGGCACACGAGCCCATGCCCGATAGCCAC
GTGGGCCGAGAGCTGACCCGCAAGAAGGGCATCCTCTTGCAGTACCGCCTGCGCTCCACC
GCACACCTCCCGGGCCCGCTGCTCTCCATGCGGGAGCCGGCGCCTGCTGATGGCGCAGCT
TTGGAGCACAGCGAGGAGGACGGCTCCATTTACGAGATGGCCGACGACCCCGACATCTGG
GTGCGCAGCCGGCCCTGCGCCCGCGACGCCCACCGCAAGGAGATTTGCTCTGTGGCCATC
ATCTCCGGCGGGCAGGGCTACCGCAACTTTGGCAGCGCTCTGGGCAGCAGTGGGAGGCAG
GCCCCGTGTGGGGAGACGGACAGCACCCTCCTCATCTGGCAGGTGCCCTTGATGCTATAG
Protein Properties
Number of Residues 1279
Molecular Weight 140363.9
Theoretical pI 5.76
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Rho guanine nucleotide exchange factor 10-like protein
MASSNPPPQPAIGDQLVPGVPGPSSEAEDDPGEAFEFDDSDDEEDTSAALGVPSLAPERD
TDPPLIHLDSIPVTDPDPAAAPPGTGVPAWVSNGDAADAAFSGARHSSWKRKSSRRIDRF
TFPALEEDVIYDDVPCESPDAHQPGAERNLLYEDAHRAGAPRQAEDLGWSSSEFESYSED
SGEEAKPEVEVEPAKHRVSFQPKLSPDLTRLKERYARTKRDILALRVGGRDMQELKHKYD
CKMTQLMKAAKSGTKDGLEKTRMAVMRKVSFLHRKDVLGDSEEEDMGLLEVSVSDIKPPA
PELGPMPEGLSPQQVVRRHILGSIVQSEGSYVESLKRILQDYRNPLMEMEPKALSARKCQ
VVFFRVKEILHCHSMFQIALSSRVAEWDSTEKIGDLFVASFSKSMVLDVYSDYVNNFTSA
MSIIKKACLTKPAFLEFLKRRQVCSPDRVTLYGLMVKPIQRFPQFILLLQDMLKNTPRGH
PDRLSLQLALTELETLAEKLNEQKRLADQVAEIQQLTKSVSDRSSLNKLLTSGQRQLLLC
ETLTETVYGDRGQLIKSKERRVFLLNDMLVCANINFKPANHRGQLEISSLVPLGPKYVVK
WNTALPQVQVVEVGQDGGTYDKDNVLIQHSGAKKASASGQAQNKVYLGPPRLFQELQDLQ
KDLAVVEQITLLISTLHGTYQNLNMTVAQDWCLALQRLMRVKEEEIHSANKCRLRLLLPG
KPDKSGRPISFMVVFITPNPLSKISWVNRLHLAKIGLREENQPGWLCPDEDKKSKAPFWC
PILACCIPAFSSRALSLQLGALVHSPVNCPLLGFSAVSTSLPQGYLWVGGGQEGAGGQVE
IFSLNRPSPRTVKSFPLAAPVLCMEYIPELEEEAESRDESPTVADPSATVHPTICLGLQD
GSILLYSSVDTGTQCLVSCRSPGLQPVLCLRHSPFHLLAGLQDGTLAAYPRTSGGVLWDL
ESPPVCLTVGPGPVRTLLSLEDAVWASCGPRVTVLEATTLQPQQSFEAHQDEAVSVTHMV
KAGSGVWMAFSSGTSIRLFHTETLEHLQEINIATRTTFLLPGQKHLCVTSLLICQGLLWV
GTDQGVIVLLPVPRLEGIPKITGKGMVSLNGHCGPVAFLAVATSILAPDILRSDQEEAEG
PRAEEDKPDGQAHEPMPDSHVGRELTRKKGILLQYRLRSTAHLPGPLLSMREPAPADGAA
LEHSEEDGSIYEMADDPDVWVRSRPCARDAHRKEICSVAIISGGQGYRNFGSALGSSGRQ
APCGETDSTLLIWQVPLML
GenBank ID Protein 58761492
UniProtKB/Swiss-Prot ID Q9HCE6
UniProtKB/Swiss-Prot Entry Name ARGAL_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_018125.3
GeneCard ID ARHGEF10L
GenAtlas ID ARHGEF10L
HGNC ID HGNC:25540
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ: Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. Nat Biotechnol. 2005 Jan;23(1):94-101. Epub 2004 Dec 12. [PubMed:15592455 ]
  4. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  5. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  6. Nagase T, Kikuno R, Nakayama M, Hirosawa M, Ohara O: Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Aug 31;7(4):273-81. [PubMed:10997877 ]
  7. Winkler S, Mohl M, Wieland T, Lutz S: GrinchGEF--a novel Rho-specific guanine nucleotide exchange factor. Biochem Biophys Res Commun. 2005 Oct 7;335(4):1280-6. [PubMed:16112081 ]