Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11497
Secondary Accession Numbers
  • 17851
Name Guanine nucleotide-binding protein G(z) subunit alpha
Synonyms
  1. G(x) alpha chain
  2. Gz-alpha
Gene Name GNAZ
Protein Type Unknown
Biological Properties
General Function Involved in signal transducer activity
Specific Function Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems
Pathways Not Available
Reactions Not Available
GO Classification
Function
purine nucleotide binding
binding
nucleotide binding
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
molecular transducer activity
signal transducer activity
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Lipid-anchor
  2. Membrane
Gene Properties
Chromosome Location Chromosome:2
Locus 22q11.22
SNPs GNAZ
Gene Sequence
>1068 bp
ATGGGATGTCGGCAAAGCTCAGAGGAAAAAGAAGCAGCCCGGCGGTCCCGGAGAATTGAC
CGCCACCTGCGCTCAGAGAGCCAGCGGCAACGCCGCGAAATCAAGCTGCTCCTGCTGGGC
ACCAGCAACTCAGGCAAGAGCACCATCGTCAAACAGATGAAGATCATCCACAGCGGCGGC
TTCAACCTGGAGGCCTGCAAGGAGTACAAGCCCCTCATCATCTACAATGCCATCGACTCG
CTGACCCGCATCATCCGGGCCCTGGCCGCCCTCAGGATCGACTTCCACAACCCCGACCGC
GCCTACGATGCTGTGCAGCTCTTTGCGCTGACGGGCCCCGCTGAGAGCAAGGGCGAGATC
ACACCCGAGCTGCTGGGTGTCATGCGACGGCTCTGGGCCGACCCAGGGGCACAGGCCTGC
TTCAGCCGCTCCAGCGAGTACCACCTGGAGGACAACGCGGCCTACTACCTGAACGACCTG
GAGCGCATCGCCGCAGCTGACTATATCCCCACTGTCGAGGACATCCTGCGCTCCCGGGAC
ATGACCACGGGCATTGTGGAGAACAAGTTCACCTTCAAGGAGCTCACCTTCAAGATGGTG
GACGTGGGGGGGCAGAGGTCAGAGCGCAAAAAGTGGATCCACTGCTTCGAGGGCGTCACA
GCCATCATCTTCTGTGTGGAGCTCAGCGGCTACGACCTGAAACTCTACGAGGATAACCAG
ACAAGTCGGATGGCAGAGAGCTTGCGCCTCTTTGACTCCATCTGCAACAACAACTGGTTC
ATCAACACCTCACTCATCCTCTTCCTGAACAAGAAGGACCTGCTGGCAGAGAAGATCCGC
CGCATCCCGCTCACCATCTGCTTTCCCGAGTACAAGGGCCAGAACACGTACGAGGAGGCC
GCTGTCTACATCCAGCGGCAGTTTGAAGACCTGAACCGCAACAAGGAGACCAAGGAGATC
TACTCCCACTTCACCTGCGCCACCGACACCAGTAACATCCAGTTTGTCTTCGACGCGGTG
ACAGACGTCATCATACAGAACAATCTCAAGTACATTGGCCTTTGCTGA
Protein Properties
Number of Residues 355
Molecular Weight 40923.3
Theoretical pI 7.69
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Guanine nucleotide-binding protein G(z) subunit alpha
MGCRQSSEEKEAARRSRRIDRHLRSESQRQRREIKLLLLGTSNSGKSTIVKQMKIIHSGG
FNLEACKEYKPLIIYNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEI
TPELLGVMRRLWADPGAQACFSRSSEYHLEDNAAYYLNDLERIAAADYIPTVEDILRSRD
MTTGIVENKFTFKELTFKMVDVGGQRSERKKWIHCFEGVTAIIFCVELSGYDLKLYEDNQ
TSRMAESLRLFDSICNNNWFINTSLILFLNKKDLLAEKIRRIPLTICFPEYKGQNTYEEA
AVYIQRQFEDLNRNKETKEIYSHFTCATDTSNIQFVFDAVTDVIIQNNLKYIGLC
GenBank ID Protein 20147691
UniProtKB/Swiss-Prot ID P19086
UniProtKB/Swiss-Prot Entry Name GNAZ_HUMAN
PDB IDs Not Available
GenBank Gene ID AF493899
GeneCard ID GNAZ
GenAtlas ID GNAZ
HGNC ID HGNC:4395
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [PubMed:15461802 ]
  4. Fong HK, Yoshimoto KK, Eversole-Cire P, Simon MI: Identification of a GTP-binding protein alpha subunit that lacks an apparent ADP-ribosylation site for pertussis toxin. Proc Natl Acad Sci U S A. 1988 May;85(9):3066-70. [PubMed:3129724 ]
  5. Matsuoka M, Itoh H, Kaziro Y: Characterization of the human gene for Gx alpha, a pertussis toxin-insensitive regulatory GTP-binding protein. J Biol Chem. 1990 Aug 5;265(22):13215-20. [PubMed:2115889 ]
  6. Gagnon AW, Manning DR, Catani L, Gewirtz A, Poncz M, Brass LF: Identification of Gz alpha as a pertussis toxin-insensitive G protein in human platelets and megakaryocytes. Blood. 1991 Sep 1;78(5):1247-53. [PubMed:1908722 ]