You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11589
Secondary Accession Numbers
  • 21033
Name Ubiquitin carboxyl-terminal hydrolase 25
Synonyms
  1. Deubiquitinating enzyme 25
  2. USP on chromosome 21
  3. Ubiquitin thiolesterase 25
  4. Ubiquitin-specific-processing protease 25
Gene Name USP25
Protein Type Enzyme
Biological Properties
General Function Involved in ubiquitin thiolesterase activity
Specific Function The muscle-specific isoform (USP25m) may have a role in the regulation of muscular differentiation and function
Pathways Not Available
Reactions Not Available
GO Classification
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
ubiquitin thiolesterase activity
thiolester hydrolase activity
Process
metabolic process
catabolic process
macromolecule catabolic process
cellular macromolecule catabolic process
modification-dependent macromolecule catabolic process
modification-dependent protein catabolic process
ubiquitin-dependent protein catabolic process
Cellular Location
  1. Nucleus
  2. Isoform USP25m:Cytoplasm
Gene Properties
Chromosome Location Chromosome:2
Locus 21q11.2
SNPs USP25
Gene Sequence
>3168 bp
ATGACCGTGGAGCAGAACGTGCTGCAGCAGAGCGCGGCGCAGAAGCACCAGCAGACGTTT
TTGAATCAACTGAGAGAAATTACGGGGATTAATGACACCCAGATACTACAGCAAGCCTTG
AAGGATAGTAATGGAAACTTGGAATTAGCAGTGGCTTTCCTTACTGCGAAGAATGCTAAG
ACCCCTCAGCAGGAGGAGACAACTTACTACCAAACAGCACTTCCTGGCAATGATAGATAC
ATCAGTGTGGGAAGCCAAGCAGATACAAATGTGATTGATCTCACTGGAGATGATAAAGAT
GATCTTCAGAGAGCAATTGCCTTGAGTTTGGCCGAATCAAACAGGGCATTCAGGGAGACT
GGAATAACTGATGAGGAACAAGCCATTAGCAGAGTTCTTGAAGCCAGCATAGCAGAGAAT
AAAGCATGTTTGAAGAGGACACCTACAGAAGTTTGGAGGGATTCTCGAAACCCTTATGAT
AGAAAAAGACAGGACAAAGCTCCCGTTGGGCTAAAGAATGTTGGCAATACTTGTTGGTTT
AGTGCTGTTATTCAGTCATTATTTAATCTTTTGGAATTTAGAAGATTAGTTCTGAATTAC
AAGCCTCCATCAAATGCTCAAGATTTACCCCGAAACCAAAAGGAACATCGGAATTTGCCT
TTTATGCGTGAGCTGAGGTATCTATTTGCACTTCTTGTTGGTACCAAAAGGAAGTATGTT
GATCCATCAAGAGCAGTTGAAATTCTTAAGGATGCTTTCAAATCAAATGACTCACAGCAG
CAAGATGTGAGTGAGTTTACACACAAATTATTAGATTGGTTAGAAGATGCCTTCCAAATG
AAAGCTGAAGAGGAGACGGATGAAGAGAAGCCAAAGAACCCCATGGTAGAGTTGTTCTAT
GGCAGATTCCTGGCTGTGGGAGTACTTGAAGGTAAAAAATTTGAAAACACTGAAATGTTT
GGTCAGTACCCACTTCAGGTCAATGGGTTCAAAGATCTGCATGAGTGCCTAGAAGCTGCA
ATGATTGAAGGAGAAATTGAGTCTTTACATTCAGAGAATTCAGGAAAATCAGGCCAAGAG
CATTGGTTTACTGAATTACCACCTGTGTTAACATTTGAATTGTCAAGATTTGAATTTAAT
CAGGCATTGGGAAGACCAGAAAAAATTCACAACAAATTAGAATTTCCCCAAGTTTTATAT
TTGGACAGATACATGCACAGAAACAGAGAAATAACAAGAATTAAGAGGGAAGAGATCAAG
AGACTGAAAGATTACCTCACGGTATTACAACAAAGGCTAGAAAGATATTTAAGCTATGGT
TCCGGTCCCAAACGATTCCCCTTGGTAGATGTTCTTCAGTATGCATTGGAATTTGCCTCA
AGTAAACCTGTTTGCACTTCTCCTGTTGACGATATTGACGCTAGTTCCCCACCTAGTGGT
TCCATACCATCACAGACATTACCAAGCACAACAGAACAACAGGGAGCCCTATCTTCAGAA
CTGCCAAGCACATCACCTTCATCAGTTGCTGCCATTTCATCGAGATCAGTAATACACAAA
CCATTTACTCAGTCCCGGATACCTCCAGATTTGCCCATGCATCCGGCACCAAGGCACATA
ACGGAGGAAGAACTTTCTGTGCTGGAAAGTTGTTTACATCGCTGGAGGACAGAAATAGAA
AATGACACCAGAGATTTGCAGGAAAGCATATCCAGAATCCATCGAACAATTGAATTAATG
TACTCTGACAAATCTATGATACAAGTTCCTTATCGATTACATGCCGTTTTAGTTCACGAA
GGCCAAGCTAATGCTGGGCACTACTGGGCATATATTTTTGATCATCGTGAAAGCAGATGG
ATGAAGTACAATGATATTGCTGTGACAAAATCATCATGGGAAGAGCTAGTGAGGGACTCT
TTTGGTGGTTATAGAAATGCCAGTGCATACTGTTTAATGTACATAAATGATAAGGCACAG
TTCCTAATACAAGAGGAGTTTAATAAAGAAACTGGGCAGCCCCTTGTTGGTATAGAAACA
TTACCACCGGATTTGAGAGATTTTGTTGAGGAAGACAACCAACGATTTGAAAAAGAACTA
GAAGAATGGGATGCACAACTTGCCCAGAAAGCTTTGCAGGAAAAGCTTTTAGCGTCTCAG
AAATTGAGAGAGTCAGAGACTTCTGTGACAACAGCACAAGCAGCAGGAGACCCAGAATAT
CTAGAGCAGCCATCAAGAAGTGATTTCTCAAAGCACTTGAAAGAAGAAACTATTCAAATA
ATTACCAAGGCATCACATGAGCATGAAGATAAAAGTCCTGAAACAGTTTTGCAGTCGGCA
ATTAAGTTGGAATATGCAAGGTTGGTTAAGTTGGCCCAAGAAGACACCCCACCAGAAACC
GATTATCGTTTACATCATGTAGTGGTCTACTTTATCCAGAACCAGGCACCAAAGAAAATT
ATTGAGAAAACATTACTAGAACAATTTGGAGATAGAAATTTGAGTTTTGATGAAAGGTGT
CACAACATAATGAAAGTTGCTCAAGCCAAACTGGAAATGATAAAACCTGAAGAAGTAAAC
TTGGAGGAATATGAGGAGTGGCATCAGGATTATAGGAAATTCAGGGAAACAACTATGTAT
CTCATAATTGGGCTAGAAAATTTTCAAAGAGAAAGTTATATAGATTCCTTGCTGTTCCTC
ATCTGTGCTTATCAGAATAACAAAGAACTCTTGTCTAAAGGCTTATACAGAGGACATGAT
GAAGAATTGATATCACATTATAGAAGAGAATGTTTGCTAAAATTAAATGAGCAAGCCGCA
GAACTCTTCGAATCTGGAGAGGATCGAGAAGTAAACAATGGTTTGATTATCATGAATGAG
TTTATTGTCCCATTTTTGCCATTATTACTGGTGGATGAAATGGAAGAAAAGGATATACTA
GCTGTAGAAGATATGAGAAATCGATGGTGTTCCTACCTTGGTCAAGAAATGGAACCACAC
CTCCAAGAAAAGCTGACAGATTTTTTGCCAAAACTGCTTGATTGTTCTATGGAGATTAAA
AGTTTCCATGAGCCACCGAAGTTACCTTCATATTCCACGCATGAACTCTGTGAGCGATTT
GCCCGAATCATGTTGTCCCTCAGTCGAACTCCTGCTGATGGAAGATAA
Protein Properties
Number of Residues 1055
Molecular Weight 122216.8
Theoretical pI 5.01
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ubiquitin carboxyl-terminal hydrolase 25
MTVEQNVLQQSAAQKHQQTFLNQLREITGINDTQILQQALKDSNGNLELAVAFLTAKNAK
TPQQEETTYYQTALPGNDRYISVGSQADTNVIDLTGDDKDDLQRAIALSLAESNRAFRET
GITDEEQAISRVLEASIAENKACLKRTPTEVWRDSRNPYDRKRQDKAPVGLKNVGNTCWF
SAVIQSLFNLLEFRRLVLNYKPPSNAQDLPRNQKEHRNLPFMRELRYLFALLVGTKRKYV
DPSRAVEILKDAFKSNDSQQQDVSEFTHKLLDWLEDAFQMKAEEETDEEKPKNPMVELFY
GRFLAVGVLEGKKFENTEMFGQYPLQVNGFKDLHECLEAAMIEGEIESLHSENSGKSGQE
HWFTELPPVLTFELSRFEFNQALGRPEKIHNKLEFPQVLYLDRYMHRNREITRIKREEIK
RLKDYLTVLQQRLERYLSYGSGPKRFPLVDVLQYALEFASSKPVCTSPVDDIDASSPPSG
SIPSQTLPSTTEQQGALSSELPSTSPSSVAAISSRSVIHKPFTQSRIPPDLPMHPAPRHI
TEEELSVLESCLHRWRTEIENDTRDLQESISRIHRTIELMYSDKSMIQVPYRLHAVLVHE
GQANAGHYWAYIFDHRESRWMKYNDIAVTKSSWEELVRDSFGGYRNASAYCLMYINDKAQ
FLIQEEFNKETGQPLVGIETLPPDLRDFVEEDNQRFEKELEEWDAQLAQKALQEKLLASQ
KLRESETSVTTAQAAGDPEYLEQPSRSDFSKHLKEETIQIITKASHEHEDKSPETVLQSA
IKLEYARLVKLAQEDTPPETDYRLHHVVVYFIQNQAPKKIIEKTLLEQFGDRNLSFDERC
HNIMKVAQAKLEMIKPEEVNLEEYEEWHQDYRKFRETTMYLIIGLENFQRESYIDSLLFL
ICAYQNNKELLSKGLYRGHDEELISHYRRECLLKLNEQAAELFESGEDREVNNGLIIMNE
FIVPFLPLLLVDEMEEKDILAVEDMRNRWCSYLGQEMEPHLQEKLTDFLPKLLDCSMEIK
SFHEPPKLPSYSTHELCERFARIMLSLSRTPADGR
GenBank ID Protein 6693824
UniProtKB/Swiss-Prot ID Q9UHP3
UniProtKB/Swiss-Prot Entry Name UBP25_HUMAN
PDB IDs
GenBank Gene ID AF134213
GeneCard ID USP25
GenAtlas ID USP25
HGNC ID HGNC:12624
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  4. Bosch-Comas A, Lindsten K, Gonzalez-Duarte R, Masucci MG, Marfany G: The ubiquitin-specific protease USP25 interacts with three sarcomeric proteins. Cell Mol Life Sci. 2006 Mar;63(6):723-34. [PubMed:16501887 ]
  5. Cholay M, Reverdy C, Benarous R, Colland F, Daviet L: Functional interaction between the ubiquitin-specific protease 25 and the SYK tyrosine kinase. Exp Cell Res. 2010 Feb 15;316(4):667-75. doi: 10.1016/j.yexcr.2009.10.023. Epub 2009 Nov 10. [PubMed:19909739 ]
  6. Valero R, Bayes M, Francisca Sanchez-Font M, Gonzalez-Angulo O, Gonzalez-Duarte R, Marfany G: Characterization of alternatively spliced products and tissue-specific isoforms of USP28 and USP25. Genome Biol. 2001;2(10):RESEARCH0043. Epub 2001 Sep 13. [PubMed:11597335 ]
  7. Valero R, Marfany G, Gonzalez-Angulo O, Gonzalez-Gonzalez G, Puelles L, Gonzalez-Duarte R: USP25, a novel gene encoding a deubiquitinating enzyme, is located in the gene-poor region 21q11.2. Genomics. 1999 Dec 15;62(3):395-405. [PubMed:10644437 ]
  8. Groet J, Ives JH, Jones TA, Danton M, Flomen RH, Sheer D, Hrascan R, Pavelic K, Nizetic D: Narrowing of the region of allelic loss in 21q11-21 in squamous non-small cell lung carcinoma and cloning of a novel ubiquitin-specific protease gene from the deleted segment. Genes Chromosomes Cancer. 2000 Feb;27(2):153-61. [PubMed:10612803 ]
  9. Meulmeester E, Kunze M, Hsiao HH, Urlaub H, Melchior F: Mechanism and consequences for paralog-specific sumoylation of ubiquitin-specific protease 25. Mol Cell. 2008 Jun 6;30(5):610-9. doi: 10.1016/j.molcel.2008.03.021. [PubMed:18538659 ]
  10. Denuc A, Bosch-Comas A, Gonzalez-Duarte R, Marfany G: The UBA-UIM domains of the USP25 regulate the enzyme ubiquitination state and modulate substrate recognition. PLoS One. 2009;4(5):e5571. doi: 10.1371/journal.pone.0005571. Epub 2009 May 15. [PubMed:19440361 ]