| Identification |
| HMDB Protein ID
| HMDBP11629 |
| Secondary Accession Numbers
| None |
| Name
| Adenosine deaminase CECR1 |
| Synonyms
|
- Cat eye syndrome critical region protein 1
|
| Gene Name
| CECR1 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Adenosine deaminase that may contribute to the degradation of extracellular adenosine, a signaling molecule that controls a variety of cellular responses. Requires elevated adenosine levels for optimal enzyme activity. Binds to cell surfaces via proteoglycans and may play a role in the regulation of cell proliferation and differentiation, independently of its enzyme activity.
|
| Pathways
|
Not Available
|
| Reactions
|
| Adenosine + Water → Inosine + Ammonia |
details
|
|
| GO Classification
|
| Biological Process |
| multicellular organismal development |
| adenosine catabolic process |
| hypoxanthine salvage |
| inosine biosynthetic process |
| purine ribonucleoside monophosphate biosynthetic process |
| Cellular Component |
| extracellular space |
| Golgi apparatus |
| Molecular Function |
| metal ion binding |
| zinc ion binding |
| heparin binding |
| adenosine deaminase activity |
| adenosine receptor binding |
| growth factor activity |
| proteoglycan binding |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 22 |
| Locus
| 22q11.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 58933.1 |
| Theoretical pI
| 7.907 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|29029550|ref|NP_059120.2| adenosine deaminase CECR1 isoform a precursor [Homo sapiens]
MLVDGPSERPALCFLLLAVAMSFFGSALSIDETRAHLLLKEKMMRLGGRLVLNTKEELAN
ERLMTLKIAE
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NZK5 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:1839 |
| References |
| General References
| Not Available |