| Identification |
| HMDB Protein ID
| HMDBP11634 |
| Secondary Accession Numbers
| None |
| Name
| Cyclic GMP-AMP synthase |
| Synonyms
|
- cGAMP synthase
- cGAS
- h-cGAS
- Mab-21 domain-containing protein 1
|
| Gene Name
| MB21D1 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Nucleotidyltransferase that catalyzes formation of cyclic GMP-AMP (cGAMP) from ATP and GTP and exhibits antiviral activity. Has antiviral activity by acting as a key cytosolic DNA sensor, the presence of DNA in the cytoplasm being a danger signal that triggers the immune responses. Binds cytosolic DNA directly, leading to activation and synthesis of cGAMP, a second messenger that binds to and activates TMEM173/STING, thereby triggering type-I interferon production.
|
| Pathways
|
Not Available
|
| Reactions
|
| Adenosine triphosphate + Guanosine triphosphate → Pyrophosphate + cyclic GMP-AMP |
details
|
|
| GO Classification
|
| Biological Process |
| defense response to virus |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 6 |
| Locus
| 6q13 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 58813.885 |
| Theoretical pI
| 9.488 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|115511030|ref|NP_612450.2| cyclic GMP-AMP synthase [Homo sapiens]
MQPWHGKAMQRASEAGATAPKASARNARGAPMDPTESPAAPEAALPKAGKFGPARKSGSR
QKKSAPDTQE
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8N884 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:21367 |
| References |
| General References
| Not Available |