Hmdb loader
Identification
HMDB Protein ID HMDBP11650
Secondary Accession Numbers None
Name Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2
Synonyms
  1. Nuclear LIM interactor-interacting factor 2
  2. Protein OS-4
  3. Small C-terminal domain phosphatase 2
  4. Small CTD phosphatase 2
  5. NLI-interacting factor 2
  6. SCP2
Gene Name CTDSP2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residues repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A. Negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation. Recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells. May contribute to the development of sarcomas.
Pathways Not Available
Reactions
A phosphoprotein + Water → a protein + Phosphate details
GO Classification
Biological Process
activation of signaling protein activity involved in unfolded protein response
protein dephosphorylation
Cellular Component
nucleoplasm
Molecular Function
metal ion binding
CTD phosphatase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 12
Locus 12q14.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 30663.73
Theoretical pI 5.524
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|93004102|ref|NP_005721.3| carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 [Homo sapiens]
MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHVGQSSSSTELA
AYKEEANTIA
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O14595
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:17077
References
General References Not Available