Showing Protein ATP-dependent RNA helicase DDX42 (HMDBP11675)
Identification | ||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11675 | |||||||||||
Secondary Accession Numbers | None | |||||||||||
Name | ATP-dependent RNA helicase DDX42 | |||||||||||
Synonyms |
|
|||||||||||
Gene Name | DDX42 | |||||||||||
Protein Type | Unknown | |||||||||||
Biological Properties | ||||||||||||
General Function | Not Available | |||||||||||
Specific Function | ATP-dependent RNA helicase. Binds to partially double-stranded RNAs (dsRNAs) in order to unwind RNA secondary structures. Unwinding is promoted in the presence of single-strand binding proteins. Mediates also RNA duplex formation thereby displacing the single-strand RNA binding protein. ATP and ADP modulate its activity: ATP binding and hydrolysis by DDX42 triggers RNA strand separation, whereas the ADP-bound form of the protein triggers annealing of complementary RNA strands. Involved in the survival of cells by interacting with TP53BP2 and thereby counteracting the apoptosis-stimulating activity of TP53BP2. Relocalizes TP53BP2 to the cytoplasm. | |||||||||||
Pathways |
|
|||||||||||
Reactions |
|
|||||||||||
GO Classification |
|
|||||||||||
Cellular Location | Not Available | |||||||||||
Gene Properties | ||||||||||||
Chromosome Location | 17 | |||||||||||
Locus | 17q23.3 | |||||||||||
SNPs | Not Available | |||||||||||
Gene Sequence | Not Available | |||||||||||
Protein Properties | ||||||||||||
Number of Residues | Not Available | |||||||||||
Molecular Weight | 102974.485 | |||||||||||
Theoretical pI | 7.015 | |||||||||||
Pfam Domain Function | Not Available | |||||||||||
Signals | Not Available | |||||||||||
Transmembrane Regions | Not Available | |||||||||||
Protein Sequence |
>>gi|45446743|ref|NP_031398.2| ATP-dependent RNA helicase DDX42 [Homo sapiens] MNWNKGGPGTKRGFGFGGFAISAGKKEEPKLPQQSHSAFGATSSSSGFGKSAPPQLPSFY KIGSKRANFD |
|||||||||||
External Links | ||||||||||||
GenBank ID Protein | Not Available | |||||||||||
UniProtKB/Swiss-Prot ID | Q86XP3 | |||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||||
PDB IDs | Not Available | |||||||||||
GenBank Gene ID | Not Available | |||||||||||
GeneCard ID | Not Available | |||||||||||
GenAtlas ID | Not Available | |||||||||||
HGNC ID | HGNC:18676 | |||||||||||
References | ||||||||||||
General References | Not Available |