| Identification |
|---|
| HMDB Protein ID
| HMDBP11725 |
| Secondary Accession Numbers
| None |
| Name
| Dihydrofolate reductase, mitochondrial |
| Synonyms
|
- Dihydrofolate reductase-like protein 1
|
| Gene Name
| DHFRL1 |
| Protein Type
| Unknown |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Key enzyme in folate metabolism. Contributes to the de novo mitochondrial thymidylate biosynthesis pathway. Required to prevent uracil accumulation in mtDNA. Binds its own mRNA and that of DHFR.
|
| Pathways
|
- Folate biosynthesis
- One carbon pool by folate
- tetrahydrofolate biosynthesis
|
| Reactions
|
| Tetrahydrofolic acid + NADP → Dihydrofolic acid + NADPH |
details
|
| Tetrahydrofolic acid + NAD → Dihydrofolic acid + NADH + Hydrogen Ion |
details
|
| Tetrahydrofolic acid + NAD → Folic acid + NADH + Hydrogen Ion |
details
|
| Tetrahydrofolic acid + NADP → Dihydrofolic acid + NADPH + Hydrogen Ion |
details
|
| Tetrahydrofolic acid + NADP → Folic acid + NADPH + Hydrogen Ion |
details
|
| Dihydrofolic acid + NAD → Folic acid + NADH + Hydrogen Ion |
details
|
| Dihydrofolic acid + NADP → Folic acid + NADPH + Hydrogen Ion |
details
|
|
| GO Classification
|
| Biological Process |
| nucleotide biosynthetic process |
| tetrahydrofolate metabolic process |
| one-carbon metabolic process |
| glycine biosynthetic process |
| tetrahydrofolate biosynthetic process |
| thymidine biosynthetic process |
| Cellular Component |
| mitochondrial matrix |
| mitochondrial inner membrane |
| Molecular Function |
| NADP binding |
| dihydrofolate reductase activity |
| mRNA binding |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 3 |
| Locus
| 3q11.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 21619.88 |
| Theoretical pI
| 7.972 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|307548863|ref|NP_001182572.1| dihydrofolate reductase, mitochondrial [Homo sapiens]
MFLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKD
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q86XF0 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:27309 |
| References |
|---|
| General References
| Not Available |
