Showing Protein Procollagen galactosyltransferase 1 (HMDBP11757)
Identification | ||||||||
---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11757 | |||||||
Secondary Accession Numbers | None | |||||||
Name | Procollagen galactosyltransferase 1 | |||||||
Synonyms |
|
|||||||
Gene Name | GLT25D1 | |||||||
Protein Type | Unknown | |||||||
Biological Properties | ||||||||
General Function | Not Available | |||||||
Specific Function | Has a beta-galactosyltransferase activity; transfers beta-galactose to hydroxylysine residues of collagen. | |||||||
Pathways |
|
|||||||
Reactions |
|
|||||||
GO Classification |
|
|||||||
Cellular Location | Not Available | |||||||
Gene Properties | ||||||||
Chromosome Location | 19 | |||||||
Locus | 19p13.11 | |||||||
SNPs | Not Available | |||||||
Gene Sequence | Not Available | |||||||
Protein Properties | ||||||||
Number of Residues | Not Available | |||||||
Molecular Weight | 71635.385 | |||||||
Theoretical pI | 7.311 | |||||||
Pfam Domain Function |
|
|||||||
Signals | Not Available | |||||||
Transmembrane Regions | Not Available | |||||||
Protein Sequence |
>>gi|31377697|ref|NP_078932.2| procollagen galactosyltransferase 1 precursor [Homo sapiens] MAAAPRAGRRRGQPLLALLLLLLAPLPPGAPPGADAYFPEERWSPESPLQAPRVLIALLA RNAAHALPTT |
|||||||
External Links | ||||||||
GenBank ID Protein | Not Available | |||||||
UniProtKB/Swiss-Prot ID | Q8NBJ5 | |||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||
PDB IDs | Not Available | |||||||
GenBank Gene ID | Not Available | |||||||
GeneCard ID | Not Available | |||||||
GenAtlas ID | Not Available | |||||||
HGNC ID | HGNC:26182 | |||||||
References | ||||||||
General References | Not Available |