Showing Protein HRAS-like suppressor 3 (HMDBP11787)
Identification | |||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11787 | ||||||||||||||||||||||||||
Secondary Accession Numbers | None | ||||||||||||||||||||||||||
Name | HRAS-like suppressor 3 | ||||||||||||||||||||||||||
Synonyms |
|
||||||||||||||||||||||||||
Gene Name | PLA2G16 | ||||||||||||||||||||||||||
Protein Type | Unknown | ||||||||||||||||||||||||||
Biological Properties | |||||||||||||||||||||||||||
General Function | Not Available | ||||||||||||||||||||||||||
Specific Function | Exhibits PLA1/2 activity, catalyzing the calcium-independent hydrolysis of acyl groups in various phosphotidylcholines (PC) and phosphatidylethanolamine (PE). For most substrates, PLA1 activity is much higher than PLA2 activity. Specifically catalyzes the release of fatty acids from phospholipids in adipose tissue (By similarity). N- and O-acylation activity is hardly detectable. Might decrease protein phosphatase 2A (PP2A) activity. | ||||||||||||||||||||||||||
Pathways |
|
||||||||||||||||||||||||||
Reactions |
|
||||||||||||||||||||||||||
GO Classification |
|
||||||||||||||||||||||||||
Cellular Location | Not Available | ||||||||||||||||||||||||||
Gene Properties | |||||||||||||||||||||||||||
Chromosome Location | 11 | ||||||||||||||||||||||||||
Locus | 11q12.3 | ||||||||||||||||||||||||||
SNPs | Not Available | ||||||||||||||||||||||||||
Gene Sequence | Not Available | ||||||||||||||||||||||||||
Protein Properties | |||||||||||||||||||||||||||
Number of Residues | Not Available | ||||||||||||||||||||||||||
Molecular Weight | 17936.515 | ||||||||||||||||||||||||||
Theoretical pI | 7.98 | ||||||||||||||||||||||||||
Pfam Domain Function | Not Available | ||||||||||||||||||||||||||
Signals | Not Available | ||||||||||||||||||||||||||
Transmembrane Regions | Not Available | ||||||||||||||||||||||||||
Protein Sequence |
>>gi|189571621|ref|NP_001121675.1| HRAS-like suppressor 3 [Homo sapiens] MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIV KKELLYDVAG |
||||||||||||||||||||||||||
External Links | |||||||||||||||||||||||||||
GenBank ID Protein | Not Available | ||||||||||||||||||||||||||
UniProtKB/Swiss-Prot ID | P53816 | ||||||||||||||||||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||||||||||||||||||
PDB IDs | |||||||||||||||||||||||||||
GenBank Gene ID | Not Available | ||||||||||||||||||||||||||
GeneCard ID | Not Available | ||||||||||||||||||||||||||
GenAtlas ID | Not Available | ||||||||||||||||||||||||||
HGNC ID | HGNC:17825 | ||||||||||||||||||||||||||
References | |||||||||||||||||||||||||||
General References | Not Available |