Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11811
Secondary Accession Numbers None
Name Epididymis-specific alpha-mannosidase
Synonyms
  1. Mannosidase alpha class 2B member 2
Gene Name MAN2B2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Not Available
Pathways
  • Other glycan degradation
Reactions
+ Water → + D-Mannose details
+ Water → + D-Mannose details
GO Classification
Biological Process
mannose metabolic process
Cellular Component
extracellular region
Molecular Function
metal ion binding
carbohydrate binding
zinc ion binding
alpha-mannosidase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 4
Locus 4p16.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 113978.29
Theoretical pI 7.235
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|50659093|ref|NP_056089.1| epididymis-specific alpha-mannosidase precursor [Homo sapiens]
MGQLCWLPLLAPLLLLRPPGVQSAGPIRAFVVPHSHMDVGWVYTVQESMRAYAANVYTSV
VEELARGQQR
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9Y2E5
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:29623
References
General References Not Available