You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11870
Secondary Accession Numbers None
Name Dynamin-like 120 kDa protein, mitochondrial
Synonyms
  1. Optic atrophy protein 1
Gene Name OPA1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Dynamin-related GTPase required for mitochondrial fusion and regulation of apoptosis. May form a diffusion barrier for proteins stored in mitochondrial cristae. Proteolytic processing in response to intrinsic apoptotic signals may lead to disassembly of OPA1 oligomers and release of the caspase activator cytochrome C (CYCS) into the mitochondrial intermembrane space. Dynamin-like 120 kDa protein, form S1: Inactive form produced by cleavage at S1 position by OMA1 following stress conditions that induce loss of mitochondrial membrane potential, leading to negative regulation of mitochondrial fusion.
Pathways Not Available
Reactions
Guanosine triphosphate + Water → Guanosine diphosphate + Phosphoric acid details
GO Classification
Biological Process
negative regulation of release of cytochrome c from mitochondria
mitochondrial fission
apoptotic process
axon transport of mitochondrion
cellular senescence
inner mitochondrial membrane organization
negative regulation of intrinsic apoptotic signaling pathway
visual perception
mitochondrial fusion
neural tube closure
Cellular Component
mitochondrial crista
dendrite
mitochondrial outer membrane
integral to membrane
mitochondrial intermembrane space
Molecular Function
magnesium ion binding
GTPase activity
GTP binding
Cellular Location Not Available
Gene Properties
Chromosome Location 3
Locus 3q28-q29
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 111629.755
Theoretical pI 7.873
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|224831243|ref|NP_056375.2| dynamin-like 120 kDa protein, mitochondrial isoform 1 [Homo sapiens]
MWRLRRAAVACEVCQSLVKHSSGIKGSLPLQKLHLVSRSIYHSHHPTLKLQRPQLRTSFQ
QFSSLTNLPL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O60313
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:8140
References
General References Not Available