Hmdb loader
Identification
HMDB Protein ID HMDBP11896
Secondary Accession Numbers None
Name Putative histone-lysine N-methyltransferase PRDM6
Synonyms
  1. PR domain zinc finger protein 6
  2. PR domain-containing protein 6
Gene Name PRDM6
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Putative histone methyltransferase that acts as a transcriptional repressor of smooth muscle gene expression. Promotes the transition from differentiated to proliferative smooth muscle by suppressing differentiation and maintaining the proliferative potential of vascular smooth muscle cells. Also plays a role in endothelial cells by inhibiting endothelial cell proliferation, survival and differentiation. It is unclear whether it has histone methyltransferase activity in vivo. According to some authors, it does not act as a histone methyltransferase by itself and represses transcription by recruiting EHMT2/G9a. According to others, it possesses histone methyltransferase activity when associated with other proteins and specifically methylates 'Lys-20' of histone H4 in vitro. 'Lys-20' methylation represents a specific tag for epigenetic transcriptional repression (By similarity).
Pathways Not Available
Reactions
S-Adenosylmethionine + L-lysine-[histone] → S-Adenosylhomocysteine + N(6)-methyl-L-lysine-[histone] details
GO Classification
Biological Process
histone lysine methylation
negative regulation of smooth muscle cell differentiation
neurogenesis
negative regulation of transcription, DNA-dependent
transcription, DNA-dependent
Cellular Component
nucleus
Molecular Function
nucleic acid binding
histone-lysine N-methyltransferase activity
metal ion binding
zinc ion binding
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus 5q23.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 64451.23
Theoretical pI 7.699
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|210031233|ref|NP_001129711.1| putative histone-lysine N-methyltransferase PRDM6 [Homo sapiens]
MLKPGDPGGSAFLKVDPAYLQHWQQLFPHGGAGPLKGSGAAGLLSAPQPLQPPPPPPPPE
RAEPPPDSLR
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NQX0
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:9350
References
General References Not Available