Showing Protein Tyrosine-protein phosphatase non-receptor type 20 (HMDBP11902)
Identification | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11902 | |||||||||
Secondary Accession Numbers | None | |||||||||
Name | Tyrosine-protein phosphatase non-receptor type 20 | |||||||||
Synonyms |
|
|||||||||
Gene Name | PTPN20A | |||||||||
Protein Type | Unknown | |||||||||
Biological Properties | ||||||||||
General Function | Not Available | |||||||||
Specific Function | Tyrosine-protein phosphatase targeted to sites of actin polymerization in response of varied extracellular stimuli. Has tyrosine phosphatase activity towards various tyrosyl phosphorylated substrates. | |||||||||
Pathways | Not Available | |||||||||
Reactions |
|
|||||||||
GO Classification |
|
|||||||||
Cellular Location | Not Available | |||||||||
Gene Properties | ||||||||||
Chromosome Location | 10 | |||||||||
Locus | 10q11.22 | |||||||||
SNPs | Not Available | |||||||||
Gene Sequence | Not Available | |||||||||
Protein Properties | ||||||||||
Number of Residues | Not Available | |||||||||
Molecular Weight | 48422.455 | |||||||||
Theoretical pI | 5.768 | |||||||||
Pfam Domain Function | Not Available | |||||||||
Signals | Not Available | |||||||||
Transmembrane Regions | Not Available | |||||||||
Protein Sequence |
>>gi|108802604|ref|NP_001035816.1| protein tyrosine phosphatase, non-receptor type 20 isoform 1 [Homo sapiens] MSSPRDFRAEPVNDYEGNDSEAEDLNFRETLPSSSQENTPRSKVFENKVNSEKVKLSLRN FPHNDYEDVF |
|||||||||
External Links | ||||||||||
GenBank ID Protein | Not Available | |||||||||
UniProtKB/Swiss-Prot ID | Q4JDL3 | |||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||
PDB IDs | Not Available | |||||||||
GenBank Gene ID | Not Available | |||||||||
GeneCard ID | Not Available | |||||||||
GenAtlas ID | Not Available | |||||||||
HGNC ID | HGNC:23423 | |||||||||
References | ||||||||||
General References | Not Available |