Showing Protein Glutaminyl-peptide cyclotransferase-like protein (HMDBP11905)
Identification | |||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11905 | ||||||||||||
Secondary Accession Numbers | None | ||||||||||||
Name | Glutaminyl-peptide cyclotransferase-like protein | ||||||||||||
Synonyms |
|
||||||||||||
Gene Name | QPCTL | ||||||||||||
Protein Type | Unknown | ||||||||||||
Biological Properties | |||||||||||||
General Function | Not Available | ||||||||||||
Specific Function | Responsible for the biosynthesis of pyroglutamyl peptides. | ||||||||||||
Pathways | Not Available | ||||||||||||
Reactions |
|
||||||||||||
GO Classification |
|
||||||||||||
Cellular Location | Not Available | ||||||||||||
Gene Properties | |||||||||||||
Chromosome Location | 19 | ||||||||||||
Locus | 19q13.32 | ||||||||||||
SNPs | Not Available | ||||||||||||
Gene Sequence | Not Available | ||||||||||||
Protein Properties | |||||||||||||
Number of Residues | Not Available | ||||||||||||
Molecular Weight | 32911.255 | ||||||||||||
Theoretical pI | 10.745 | ||||||||||||
Pfam Domain Function | Not Available | ||||||||||||
Signals | Not Available | ||||||||||||
Transmembrane Regions | Not Available | ||||||||||||
Protein Sequence |
>>gi|254281335|ref|NP_001156849.1| glutaminyl-peptide cyclotransferase-like protein isoform 2 [Homo sapiens] MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTE ELPLGRELRV |
||||||||||||
External Links | |||||||||||||
GenBank ID Protein | Not Available | ||||||||||||
UniProtKB/Swiss-Prot ID | Q9NXS2 | ||||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||||
PDB IDs | |||||||||||||
GenBank Gene ID | Not Available | ||||||||||||
GeneCard ID | Not Available | ||||||||||||
GenAtlas ID | Not Available | ||||||||||||
HGNC ID | HGNC:25952 | ||||||||||||
References | |||||||||||||
General References | Not Available |