Showing Protein Sulfotransferase 1C3 (HMDBP11965)
| Identification | ||||||||
|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11965 | |||||||
| Secondary Accession Numbers | None | |||||||
| Name | Sulfotransferase 1C3 | |||||||
| Synonyms |
|
|||||||
| Gene Name | SULT1C3 | |||||||
| Protein Type | Unknown | |||||||
| Biological Properties | ||||||||
| General Function | Not Available | |||||||
| Specific Function | Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor and has low sulphotransferase activity towards various substrates with alcohol groups (in vitro). May catalyze the sulfate conjugation of xenobiotic compounds and endogenous substrates. | |||||||
| Pathways | Not Available | |||||||
| Reactions |
|
|||||||
| GO Classification |
|
|||||||
| Cellular Location | Not Available | |||||||
| Gene Properties | ||||||||
| Chromosome Location | 2 | |||||||
| Locus | 2q12.3 | |||||||
| SNPs | Not Available | |||||||
| Gene Sequence | Not Available | |||||||
| Protein Properties | ||||||||
| Number of Residues | Not Available | |||||||
| Molecular Weight | 35888.345 | |||||||
| Theoretical pI | 6.911 | |||||||
| Pfam Domain Function | Not Available | |||||||
| Signals | Not Available | |||||||
| Transmembrane Regions | Not Available | |||||||
| Protein Sequence |
>>gi|56847626|ref|NP_001008743.1| sulfotransferase 1C3 [Homo sapiens] MAKIEKNAPTMEKKPELFNIMEVDGVPTLILSKEWWEKVCNFQAKPDDLILATYPKSGTT WMHEILDMIL |
|||||||
| External Links | ||||||||
| GenBank ID Protein | Not Available | |||||||
| UniProtKB/Swiss-Prot ID | Q6IMI6 | |||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||
| PDB IDs | ||||||||
| GenBank Gene ID | Not Available | |||||||
| GeneCard ID | Not Available | |||||||
| GenAtlas ID | Not Available | |||||||
| HGNC ID | HGNC:33543 | |||||||
| References | ||||||||
| General References | Not Available | |||||||