Showing Protein Probable palmitoyltransferase ZDHHC16 (HMDBP12016)
Identification | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP12016 | |||||||||
Secondary Accession Numbers | None | |||||||||
Name | Probable palmitoyltransferase ZDHHC16 | |||||||||
Synonyms |
|
|||||||||
Gene Name | ZDHHC16 | |||||||||
Protein Type | Unknown | |||||||||
Biological Properties | ||||||||||
General Function | Not Available | |||||||||
Specific Function | May be involved in apoptosis regulation (By similarity). | |||||||||
Pathways | Not Available | |||||||||
Reactions |
|
|||||||||
GO Classification |
|
|||||||||
Cellular Location | Not Available | |||||||||
Gene Properties | ||||||||||
Chromosome Location | 10 | |||||||||
Locus | 10q24.1 | |||||||||
SNPs | Not Available | |||||||||
Gene Sequence | Not Available | |||||||||
Protein Properties | ||||||||||
Number of Residues | Not Available | |||||||||
Molecular Weight | 43632.89 | |||||||||
Theoretical pI | 9.626 | |||||||||
Pfam Domain Function | Not Available | |||||||||
Signals | Not Available | |||||||||
Transmembrane Regions | Not Available | |||||||||
Protein Sequence |
>>gi|37594455|ref|NP_115703.2| probable palmitoyltransferase ZDHHC16 isoform 1 precursor [Homo sapiens] MRGQRSLLLGPARLCLRLLLLLGYRRRCPPLLRGLVQRWRYGKVCLRSLLYNSFGGSDTA VDAAFEPVYW |
|||||||||
External Links | ||||||||||
GenBank ID Protein | Not Available | |||||||||
UniProtKB/Swiss-Prot ID | Q969W1 | |||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||
PDB IDs | Not Available | |||||||||
GenBank Gene ID | Not Available | |||||||||
GeneCard ID | Not Available | |||||||||
GenAtlas ID | Not Available | |||||||||
HGNC ID | HGNC:20714 | |||||||||
References | ||||||||||
General References | Not Available |