| Version |
2.5 |
| Creation Date |
2005-11-16 15:48:42 |
| Update Date |
2009-06-23 15:43:38 |
| Accession Number |
HMDB00459 |
| Secondary Accession Numbers |
Not Available |
| Common Name |
3-Methylcrotonylglycine |
| Description |
3-Methylcrotonylglycine is an acyl glycine. Acyl glycines are normally minor metabolites of fatty acids. However, the excretion of certain acyl glycines is increased in several inborn errors of metabolism. In certain cases the measurement of these metabolites in body fluids can be used to diagnose disorders associated with mitochondrial fatty acid beta-oxidation. Acyl glycines are produced through the action of glycine N-acyltransferase (EC 2.3.1.13) which is an enzyme that catalyzes the chemical reaction:
acyl-CoA + glycine < -- > CoA + N-acylglycine. 3-Methylcrotonylglycine is a normal amino acid metabolite found in urine. Increased levels of this metabolite are found in patients suffering from leucine catabolic disorders, such as 3-methylcrotonyl-CoA carboxylase deficiency. 3-Methylcrotonylglycine is often considered to be a diagnostic marker of organic acidemias. (PMID 11170888) |
| Synonyms |
- 3-Methylcrotonyl-glycine
- 3-Methylcrotonyl glycine
- 3-Methylcrotonylglycin
- 3-Methylcrotonylglycine
- N-(3-methyl-1-oxo-2-butenyl)-Glycine
- beta-Methylcrotonylglycine
|
| Chemical IUPAC Name |
2-(3-methylbut-2-enoylamino)acetic acid |
| Chemical Formula |
C7H11NO3 |
| Chemical Structure |
 |
| Chemical Taxonomy |
| Kingdom |
|
| Super Class |
- Amino acids and Amino Acid conjugates
|
| Class |
|
| Sub Class |
- Aliphatic glycine conjugates
|
| Family |
|
| Species |
- carboxylic acid
- secondary carboxylic acid amide
- alkene
|
| Biofunction |
| — |
| Application |
| — |
| Source |
|
|
| Average Molecular Weight |
157.167 |
| Monoisotopic Molecular Weight |
157.073898 |
| Isomeric SMILES |
CC(C)=C/C(=O)NCC(O)=O |
| Canonical SMILES |
CC(C)=CC(=O)NCC(O)=O |
| KEGG Compound ID |
Not Available |
| BioCyc ID |
Not Available |
| BiGG ID |
Not Available |
| Wikipedia Link |
Not Available |
| NuGOwiki Link |
HMDB00459  |
| Metagene Link |
HMDB00459  |
| METLIN ID |
5447  |
| PubChem Compound |
169485  |
| PubChem Substance |
747005  |
| ChEBI ID |
Not Available |
| CAS Registry Number |
33008-07-0 |
| InChI Identifier |
InChI=1/C7H11NO3/c1-5(2)3-6(9)8-4-7(10)11/h3H,4H2,1-2H3,(H,8,9)(H,10,11) |
| Synthesis Reference |
Carter, S. M. Bonham; Watson, D. G.; Midgley, J. M.; Logan, R. W. Synthesis and characterization of acyl glycines. Their measurement in single blood spots by gas chromatography-mass spectrometry to diagnose inborn errors of metabolism. Journal of Chromatography, B: Biomedical Applications (1996), 677(1), 29-35. |
| Melting Point (Experimental) |
Not Available |
| Experimental Water Solubility |
Not Available
Source: PhysProp
|
| Predicted Water Solubility |
7.64 mg/mL [Predicted by ALOGPS]
Calculated using ALOGPS
|
| Physiological Charge |
-1 |
| State |
Solid |
| Experimental LogP/Hydrophobicity |
Not Available
Source: PhysProp
|
| Predicted LogP/Hydrophobicity |
0.02 [Predicted by ALOGPS]; -2.2 [Predicted by PubChem via XLOGP]
Calculated using ALOGPS
|
| Material Safety Data Sheet (MSDS) |
Not Available |
| MOL File |
Show |
| SDF File |
Show |
| PDB File |
Show |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
Not Available |
| Experimental 1H NMR Spectrum |
Download Spectrum Download FID (Varian) Show Experimental Conditions  |
| Experimental 13C NMR Spectrum |
Not Available |
| Experimental 13C HSQC Spectrum |
Download Spectrum Download FID (Bruker) Show Experimental Conditions  |
| Predicted 1H NMR Spectrum |
Show Image Show Peaklist
|
| Predicted 13C NMR Spectrum |
Show Image Show Peaklist
|
| Mass Spectrum |
|
| Simplified TOCSY Spectrum |
Not Available |
| BMRB Spectrum |
Not Available |
| Cellular Location |
|
| Biofluid Location |
|
| Tissue Location |
| Tissue |
References |
| Fibroblasts |
— |
|
| Concentrations (Normal) |
| Biofluid |
Urine |
| Value |
1.0 (0.00-2.0) umol/mmol creatinine |
| Age |
Adult:>18 yrs old |
| Sex |
Both |
| Patient information |
Normal |
| Comments |
Not Available |
| References |
|
| Biofluid |
Urine |
| Value |
1.0 (0.0-2.0) umol/mmol creatinine |
| Age |
Adult:>18 yrs old |
| Sex |
Both |
| Patient information |
Normal |
| Comments |
Not Available |
| References |
|
| Biofluid |
Urine |
| Value |
1.0 (0.0-2.0) umol/mmol creatinine |
| Age |
Adult:>18 yrs old |
| Sex |
Both |
| Patient information |
Normal |
| Comments |
Not Available |
| References |
|
|
| Concentrations (Abnormal) |
| Biofluid |
Urine |
| Value |
225.0 (0.00-450.0) umol/mmol creatinine |
| Age |
Adult:>18 yrs old |
| Sex |
Both |
| Condition |
3-Hydroxy-3-methylglutaryl-CoA lyase deficiency |
| Comments |
Not Available |
| References |
|
| Biofluid |
Urine |
| Value |
700.0 (400.0-1000.0) umol/mmol creatinine |
| Age |
Adult:>18 yrs old |
| Sex |
Both |
| Comments |
Not Available |
| References |
|
| Biofluid |
Urine |
| Value |
27.5 (5.0-50.0) umol/mmol creatinine |
| Age |
Adult:>18 yrs old |
| Sex |
Both |
| Condition |
Biotinidase deficiency |
| Comments |
Not Available |
| References |
|
|
| Associated Disorders |
| Condition |
References |
| 3-Hydroxy-3-methylglutaryl-CoA lyase deficiency |
|
| Biotinidase deficiency |
|
|
| OMIM ID |
- 246450
(3-Hydroxy-3-methylglutaryl-CoA lyase deficiency)
- 253260
(Biotinidase deficiency)
|
| Pathways |
Not Available
|
| General References |
- Wysocki SJ, Hahnel R: 3-Methylcrotonylglycine excretion in 3-hydroxy-3-methylglutaric aciduria. Clin Chim Acta. 1978 May 16;86(1):101-8. [PubMed
]
- Koeberl DD, Millington DS, Smith WE, Weavil SD, Muenzer J, McCandless SE, Kishnani PS, McDonald MT, Chaing S, Boney A, Moore E, Frazier DM: Evaluation of 3-methylcrotonyl-CoA carboxylase deficiency detected by tandem mass spectrometry newborn screening. J Inherit Metab Dis. 2003;26(1):25-35. [PubMed
]
- Baykal T, Gokcay GH, Ince Z, Dantas MF, Fowler B, Baumgartner MR, Demir F, Can G, Demirkol M: Consanguineous 3-methylcrotonyl-CoA carboxylase deficiency: early-onset necrotizing encephalopathy with lethal outcome. J Inherit Metab Dis. 2005;28(2):229-33. [PubMed
]
- Cowan MJ, Wara DW, Packman S, Ammann AJ, Yoshino M, Sweetman L, Nyhan W: Multiple biotin-dependent carboxylase deficiencies associated with defects in T-cell and B-cell immunity. Lancet. 1979 Jul 21;2(8134):115-8. [PubMed
]
- Gallardo ME, Desviat LR, Rodriguez JM, Esparza-Gordillo J, Perez-Cerda C, Perez B, Rodriguez-Pombo P, Criado O, Sanz R, Morton DH, Gibson KM, Le TP, Ribes A, de Cordoba SR, Ugarte M, Penalva MA: The molecular basis of 3-methylcrotonylglycinuria, a disorder of leucine catabolism. Am J Hum Genet. 2001 Feb;68(2):334-46. Epub 2001 Jan 17. [PubMed
]
- Chantin C, Bonin B, Boulieu R, Bory C: Liquid-chromatographic study of purine metabolism abnormalities in purine nucleoside phosphorylase deficiency. Clin Chem. 1996 Feb;42(2):326-8. [PubMed
]
|
| Metabolic Enzymes |
- Glycine N-acyltransferase
- Glycine N-acyltransferase-like protein 1
- Glycine N-acyltransferase-like protein 2
- Glycine N-acyltransferase-like protein 3
|
|
Enzyme 1
[top]
|
| Enzyme 1 ID |
12971 |
| Enzyme 1 Name |
Glycine N-acyltransferase |
| Enzyme 1 Synonyms |
- Acyl-CoA:glycine N-acyltransferase
- AAc
- Aralkyl acyl-CoA N-acyltransferase
- Aralkyl acyl-CoA:amino acid N-acyltransferase
- HRP-1(CLP)
|
| Enzyme 1 Gene Name |
GLYAT |
| Enzyme 1 Protein Sequence |
>Glycine N-acyltransferase
MMLPLQGAQMLQMLEKSLRKSLPASLKVYGTVFHINHGNPFNLKAVVDKWPDFNTVVVCP
QEQDMTDDLDHYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAA
IKSFKVKQTQRILYMAAETAKELTPFLLKSKILSPSGGKPKAINQEMFKLSSMDVTHAHL
VNKFWHFGGNERSQRFIERCIQTFPTCCLLGPEGTPVCWDLMDQTGEMRMAGTLPEYRLH
GLVTYVIYSHAQKLGKLGFPVYSHVDYSNEAMQKMSYTLQHVPIPRSWNQWNCVPL
|
| Enzyme 1 Number of Residues |
296 |
| Enzyme 1 Molecular Weight |
33898 |
| Enzyme 1 Theoretical pI |
8.28 |
| Enzyme 1 GO Classification |
Not Available |
| Enzyme 1 General Function |
Not Available |
| Enzyme 1 Specific Function |
Mitochondrial acyltransferase which transfers the acyl group to the N-terminus of glycine. Can conjugate a multitude of substrates to form a variety of N-acylglycines |
| Enzyme 1 Pathways |
Not Available |
| Enzyme 1 Reactions |
- Acyl-CoA + glycine = CoA + N-acylglycine
|
| Enzyme 1 Pfam Domain Function |
|
| Enzyme 1 Signals |
|
| Enzyme 1 Transmembrane Regions |
|
| Enzyme 1 Essentiality |
Not Available |
| Enzyme 1 GenBank ID Protein |
2554941  |
| Enzyme 1 UniProtKB/Swiss-Prot ID |
Q6IB77  |
| Enzyme 1 UniProtKB/Swiss-Prot Entry Name |
GLYAT_HUMAN  |
| Enzyme 1 PDB ID |
Not Available |
| Enzyme 1 Cellular Location |
Not Available |
| Enzyme 1 Gene Sequence |
Not Available |
| Enzyme 1 GenBank Gene ID |
AF023466  |
| Enzyme 1 GeneCard ID |
Q6IB77  |
| Enzyme 1 GenAtlas ID |
GLYAT  |
| Enzyme 1 HGNC ID |
HGNC:13734  |
| Enzyme 1 Chromosome Location |
Not Available |
| Enzyme 1 Locus |
Not Available |
| Enzyme 1 SNPs |
SNPJam Report  |
| Enzyme 1 General References |
Not Available |
| Enzyme 1 Metabolite References |
Not Available |
|
Enzyme 2
[top]
|
| Enzyme 2 ID |
12972 |
| Enzyme 2 Name |
Glycine N-acyltransferase-like protein 1 |
| Enzyme 2 Synonyms |
- Acyl-CoA:glycine N-acyltransferase-like protein 1
|
| Enzyme 2 Gene Name |
GLYATL1 |
| Enzyme 2 Protein Sequence |
>Glycine N-acyltransferase-like protein 1
MILLNNSHKLLALYKSLARSIPESLKVYGSVYHINHGNPFNMEVLVDSWPEYQMVIIRPQ
KQEMTDDMDSYTNVYRMFSKEPQKSEEVLKNCEIVNWKQRLQIQGLQESLGEGIRVATFS
KSVKVEHSRALLLVTEDILKLNASSKSKLGSWAETGHPDDEFESETPNFKYAQLDVSYSG
LVNDNWKRGKNERSLHYIKRCIEDLPAACMLGPEGVPVSWVTMDPSCEVGMAYSMEKYRR
TGNMARVMVRYMKYLRQKNIPFYISVLEENEDSRRFVGQFGFFEASCEWHQWTCYPQNLV
PF
|
| Enzyme 2 Number of Residues |
302 |
| Enzyme 2 Molecular Weight |
35102 |
| Enzyme 2 Theoretical pI |
6.86 |
| Enzyme 2 GO Classification |
Not Available |
| Enzyme 2 General Function |
Not Available |
| Enzyme 2 Specific Function |
Mitochondrial acyltransferase which transfers the acyl group to the N-terminus of glycine. Can conjugate a multitude of substrates to form a variety of N-acylglycines |
| Enzyme 2 Pathways |
Not Available |
| Enzyme 2 Reactions |
- Acyl-CoA + glycine = CoA + N-acylglycine
|
| Enzyme 2 Pfam Domain Function |
|
| Enzyme 2 Signals |
|
| Enzyme 2 Transmembrane Regions |
|
| Enzyme 2 Essentiality |
Not Available |
| Enzyme 2 GenBank ID Protein |
71384826  |
| Enzyme 2 UniProtKB/Swiss-Prot ID |
Q969I3  |
| Enzyme 2 UniProtKB/Swiss-Prot Entry Name |
GLYL1_HUMAN  |
| Enzyme 2 PDB ID |
Not Available |
| Enzyme 2 Cellular Location |
Not Available |
| Enzyme 2 Gene Sequence |
Not Available |
| Enzyme 2 GenBank Gene ID |
DQ084381  |
| Enzyme 2 GeneCard ID |
Q969I3  |
| Enzyme 2 GenAtlas ID |
GLYATL1  |
| Enzyme 2 HGNC ID |
HGNC:30519  |
| Enzyme 2 Chromosome Location |
Not Available |
| Enzyme 2 Locus |
Not Available |
| Enzyme 2 SNPs |
SNPJam Report  |
| Enzyme 2 General References |
Not Available |
| Enzyme 2 Metabolite References |
Not Available |
|
Enzyme 3
[top]
|
| Enzyme 3 ID |
12973 |
| Enzyme 3 Name |
Glycine N-acyltransferase-like protein 2 |
| Enzyme 3 Synonyms |
- Acyl-CoA:glycine N-acyltransferase-like protein 2
|
| Enzyme 3 Gene Name |
GLYATL2 |
| Enzyme 3 Protein Sequence |
>Glycine N-acyltransferase-like protein 2
MLVLHNSQKLQILYKSLEKSIPESIKVYGAIFNIKDKNPFNMEVLVDAWPDYQIVITRPQ
KQEMKDDQDHYTNTYHIFTKAPDKLEEVLSYSNVISWEQTLQIQGCQEGLDEAIRKVATS
KSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNKEGNFSNMFLDASHAGLVNEHW
AFGKNERSLKYIERCLQDFLGFGVLGPEGQLVSWIVMEQSCELRMGYTVPKYRHQGNMLQ
IGYHLEKYLSQKEIPFYFHVADNNEKSLQALNNLGFKICPCGWHQWKCTPKKYC
|
| Enzyme 3 Number of Residues |
294 |
| Enzyme 3 Molecular Weight |
34278 |
| Enzyme 3 Theoretical pI |
6.67 |
| Enzyme 3 GO Classification |
Not Available |
| Enzyme 3 General Function |
Not Available |
| Enzyme 3 Specific Function |
Mitochondrial acyltransferase which transfers the acyl group to the N-terminus of glycine. Can conjugate a multitude of substrates to form a variety of N-acylglycines |
| Enzyme 3 Pathways |
Not Available |
| Enzyme 3 Reactions |
- Acyl-CoA + glycine = CoA + N-acylglycine
|
| Enzyme 3 Pfam Domain Function |
|
| Enzyme 3 Signals |
|
| Enzyme 3 Transmembrane Regions |
|
| Enzyme 3 Essentiality |
Not Available |
| Enzyme 3 GenBank ID Protein |
29243559  |
| Enzyme 3 UniProtKB/Swiss-Prot ID |
Q8WU03  |
| Enzyme 3 UniProtKB/Swiss-Prot Entry Name |
GLYL2_HUMAN  |
| Enzyme 3 PDB ID |
Not Available |
| Enzyme 3 Cellular Location |
Not Available |
| Enzyme 3 Gene Sequence |
Not Available |
| Enzyme 3 GenBank Gene ID |
AF426250  |
| Enzyme 3 GeneCard ID |
Q8WU03  |
| Enzyme 3 GenAtlas ID |
GLYATL2  |
| Enzyme 3 HGNC ID |
HGNC:24178  |
| Enzyme 3 Chromosome Location |
Not Available |
| Enzyme 3 Locus |
Not Available |
| Enzyme 3 SNPs |
SNPJam Report  |
| Enzyme 3 General References |
Not Available |
| Enzyme 3 Metabolite References |
Not Available |
|
Enzyme 4
[top]
|
| Enzyme 4 ID |
12974 |
| Enzyme 4 Name |
Glycine N-acyltransferase-like protein 3 |
| Enzyme 4 Synonyms |
Not Available |
| Enzyme 4 Gene Name |
GLYATL3 |
| Enzyme 4 Protein Sequence |
>Glycine N-acyltransferase-like protein 3
MLVLNCSTKLLILEKMLKSCFPESLKVYGAVMNINRGNPFQKEVVLDSWPDFKAVITRRQ
REAETDNLDHYTNAYAVFYKDVRAYRQLLEECDVFNWDQVFQIKGLQSELYDVSKAVANS
KQLNIKLTSFKAVHFSPVSSLPDTSFLKGPSPRLTYLSVANADLLNRTWSRGGNEQCLRY
IANLISCFPSVCVRDEKGNPVSWSITDQFATMCHGYTLPEHRRKGYSRLVALTLARKLQS
RGFPSQGNVLDDNTASISLLKSLHAEFLPCRFHRLILTPATFSGLPHL
|
| Enzyme 4 Number of Residues |
288 |
| Enzyme 4 Molecular Weight |
32704 |
| Enzyme 4 Theoretical pI |
Not Available |
| Enzyme 4 GO Classification |
Not Available |
| Enzyme 4 General Function |
Not Available |
| Enzyme 4 Specific Function |
Acyltransferase which transfers the acyl group to the N-terminus of glycine (By similarity). |
| Enzyme 4 Pathways |
Not Available |
| Enzyme 4 Reactions |
Not Available |
| Enzyme 4 Pfam Domain Function |
Not Available |
| Enzyme 4 Signals |
|
| Enzyme 4 Transmembrane Regions |
|
| Enzyme 4 Essentiality |
Not Available |
| Enzyme 4 GenBank ID Protein |
Not Available |
| Enzyme 4 UniProtKB/Swiss-Prot ID |
Q5SZD4  |
| Enzyme 4 UniProtKB/Swiss-Prot Entry Name |
GLYL3_HUMAN  |
| Enzyme 4 PDB ID |
Not Available |
| Enzyme 4 Cellular Location |
Not Available |
| Enzyme 4 Gene Sequence |
Not Available |
| Enzyme 4 GenBank Gene ID |
Not Available |
| Enzyme 4 GeneCard ID |
Q5SZD4  |
| Enzyme 4 GenAtlas ID |
GLYATL3  |
| Enzyme 4 HGNC ID |
HGNC:21349  |
| Enzyme 4 Chromosome Location |
Not Available |
| Enzyme 4 Locus |
Not Available |
| Enzyme 4 SNPs |
SNPJam Report  |
| Enzyme 4 General References |
Not Available |
| Enzyme 4 Metabolite References |
Not Available |